mRNA_4975 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|348400 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_4975 ID=mRNA_4975|Name=jgi.p|Trimin1|348400|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=270bp|location=Sequence derived from alignment at Contig_23:1053000..1054617+ (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. ATGAGCGGAGGCGGCGGCGGCGGCGGCACGGACTGCACGGCTGCTGCAGCback to top protein sequence of jgi.p|Trimin1|348400 >Trimin1|348400|estExt_Genemark1.C_Ctg_230116 ID=Trimin1|348400|estExt_Genemark1.C_Ctg_230116|Name=jgi.p|Trimin1|348400|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=90bp MSGGGGGGGTDCTAAAAVAAAAVAAARHCRRRRVGSAAEAVASIYPAAVFback to top mRNA from alignment at Contig_23:1053000..1054617+ Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_4975 ID=mRNA_4975|Name=jgi.p|Trimin1|348400|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=1618bp|location=Sequence derived from alignment at Contig_23:1053000..1054617+ (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_23:1053000..1054617+ >mRNA_4975 ID=mRNA_4975|Name=jgi.p|Trimin1|348400|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=270bp|location=Sequence derived from alignment at Contig_23:1053000..1054617+ (Tribonema minus UTEX_B_3156 )back to top |