Trimin1|132345|gw1.2.62.1 (polypeptide) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|132345 vs. uniprot
Match: A0A835ZBE1_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZBE1_9STRA) HSP 1 Score: 100 bits (248), Expect = 4.840e-21 Identity = 42/42 (100.00%), Postives = 42/42 (100.00%), Query Frame = 0 Query: 1 GAAAQWCREHKTGDMQDVAHKRCMRCGLKIPKFGTEDGRPTH 42 GAAAQWCREHKTGDMQDVAHKRCMRCGLKIPKFGTEDGRPTH Sbjct: 366 GAAAQWCREHKTGDMQDVAHKRCMRCGLKIPKFGTEDGRPTH 407
BLAST of jgi.p|Trimin1|132345 vs. uniprot
Match: A0A835ZGH9_9STRA (Uncharacterized protein (Fragment) n=2 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZGH9_9STRA) HSP 1 Score: 87.0 bits (214), Expect = 1.790e-17 Identity = 35/38 (92.11%), Postives = 37/38 (97.37%), Query Frame = 0 Query: 7 CREHKTGDMQDVAHKRCMRCGLKIPKFGTEDGRPTHCG 44 CREHKTGDMQDV+HKRCM+C LKIPKFGTEDGRPTHCG Sbjct: 1 CREHKTGDMQDVSHKRCMQCRLKIPKFGTEDGRPTHCG 38
BLAST of jgi.p|Trimin1|132345 vs. uniprot
Match: A0A836CCS5_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CCS5_9STRA) HSP 1 Score: 79.0 bits (193), Expect = 2.470e-14 Identity = 32/42 (76.19%), Postives = 33/42 (78.57%), Query Frame = 0 Query: 1 GAAAQWCREHKTGDMQDVAHKRCMRCGLKIPKFGTEDGRPTH 42 G AQWC +HKTGDMQDVAHK C CGLKIP FG EDG PTH Sbjct: 9 GVGAQWCSDHKTGDMQDVAHKMCQGCGLKIPIFGIEDGSPTH 50 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|132345 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Trimin1|132345|gw1.2.62.1 ID=Trimin1|132345|gw1.2.62.1|Name=jgi.p|Trimin1|132345|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=203bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|