mRNA_559 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|132345 vs. uniprot
Match: A0A835ZBE1_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZBE1_9STRA) HSP 1 Score: 100 bits (248), Expect = 4.840e-21 Identity = 42/42 (100.00%), Postives = 42/42 (100.00%), Query Frame = 1 Query: 1 GAAAQWCREHKTGDMQDVAHKRCMRCGLKIPKFGTEDGRPTH 126 GAAAQWCREHKTGDMQDVAHKRCMRCGLKIPKFGTEDGRPTH Sbjct: 366 GAAAQWCREHKTGDMQDVAHKRCMRCGLKIPKFGTEDGRPTH 407
BLAST of jgi.p|Trimin1|132345 vs. uniprot
Match: A0A835ZGH9_9STRA (Uncharacterized protein (Fragment) n=2 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZGH9_9STRA) HSP 1 Score: 87.0 bits (214), Expect = 1.790e-17 Identity = 35/38 (92.11%), Postives = 37/38 (97.37%), Query Frame = 1 Query: 19 CREHKTGDMQDVAHKRCMRCGLKIPKFGTEDGRPTHCG 132 CREHKTGDMQDV+HKRCM+C LKIPKFGTEDGRPTHCG Sbjct: 1 CREHKTGDMQDVSHKRCMQCRLKIPKFGTEDGRPTHCG 38
BLAST of jgi.p|Trimin1|132345 vs. uniprot
Match: A0A836CCS5_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CCS5_9STRA) HSP 1 Score: 79.0 bits (193), Expect = 2.470e-14 Identity = 32/42 (76.19%), Postives = 33/42 (78.57%), Query Frame = 1 Query: 1 GAAAQWCREHKTGDMQDVAHKRCMRCGLKIPKFGTEDGRPTH 126 G AQWC +HKTGDMQDVAHK C CGLKIP FG EDG PTH Sbjct: 9 GVGAQWCSDHKTGDMQDVAHKMCQGCGLKIPIFGIEDGSPTH 50 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|132345 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_559 ID=mRNA_559|Name=jgi.p|Trimin1|132345|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=609bp|location=Sequence derived from alignment at Contig_2:306395..307003+ (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. GGGGCTGCAGCACAGTGGTGCAGGGAGCACAAGACCGGAGATATGCAAGAback to top protein sequence of jgi.p|Trimin1|132345 >Trimin1|132345|gw1.2.62.1 ID=Trimin1|132345|gw1.2.62.1|Name=jgi.p|Trimin1|132345|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=203bp GAAAQWCREHKTGDMQDVAHKRCMRCGLKIPKFGTEDGRPTHCGDCKTADback to top mRNA from alignment at Contig_2:306395..307003+ Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_559 ID=mRNA_559|Name=jgi.p|Trimin1|132345|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=609bp|location=Sequence derived from alignment at Contig_2:306395..307003+ (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_2:306395..307003+ >mRNA_559 ID=mRNA_559|Name=jgi.p|Trimin1|132345|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=609bp|location=Sequence derived from alignment at Contig_2:306395..307003+ (Tribonema minus UTEX_B_3156 )back to top |