Trimin1|182350|e_gw1.437.4.1 (polypeptide) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|182350 vs. uniprot
Match: A0A835YV36_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YV36_9STRA) HSP 1 Score: 123 bits (308), Expect = 7.480e-36 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0 Query: 1 MAGERCPQLPPDRSTASHSNSNSTSKQPQTPVIRIWGSTPAGQKACLHLHGIYPYFY 57 MAGERCPQLPPDRSTASHSNSNSTSKQPQTPVIRIWGSTPAGQKACLHLHGIYPYFY Sbjct: 1 MAGERCPQLPPDRSTASHSNSNSTSKQPQTPVIRIWGSTPAGQKACLHLHGIYPYFY 57
BLAST of jgi.p|Trimin1|182350 vs. uniprot
Match: A0A8K1C3N0_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1C3N0_PYTOL) HSP 1 Score: 57.4 bits (137), Expect = 3.640e-8 Identity = 21/29 (72.41%), Postives = 28/29 (96.55%), Query Frame = 0 Query: 29 QTPVIRIWGSTPAGQKACLHLHGIYPYFY 57 Q PV+R++G+TPAGQKACLH+HG++PYFY Sbjct: 44 QVPVMRVFGATPAGQKACLHIHGLFPYFY 72
BLAST of jgi.p|Trimin1|182350 vs. uniprot
Match: UPI001C8A68B4 (LOW QUALITY PROTEIN: DNA polymerase zeta catalytic subunit n=1 Tax=Puntigrus tetrazona TaxID=1606681 RepID=UPI001C8A68B4) HSP 1 Score: 57.4 bits (137), Expect = 3.650e-8 Identity = 21/29 (72.41%), Postives = 26/29 (89.66%), Query Frame = 0 Query: 29 QTPVIRIWGSTPAGQKACLHLHGIYPYFY 57 + PV+RIWG+TPAGQK CLHLHG++PY Y Sbjct: 34 KVPVVRIWGATPAGQKTCLHLHGMFPYIY 62
BLAST of jgi.p|Trimin1|182350 vs. uniprot
Match: UPI001CF98815 (DNA polymerase zeta catalytic subunit n=1 Tax=Protopterus annectens TaxID=7888 RepID=UPI001CF98815) HSP 1 Score: 57.4 bits (137), Expect = 3.650e-8 Identity = 22/29 (75.86%), Postives = 28/29 (96.55%), Query Frame = 0 Query: 29 QTPVIRIWGSTPAGQKACLHLHGIYPYFY 57 + PV+RI+GSTPAGQK+CLH+HGI+PYFY Sbjct: 34 KVPVVRIFGSTPAGQKSCLHVHGIFPYFY 62
BLAST of jgi.p|Trimin1|182350 vs. uniprot
Match: UPI00071E515F (DNA polymerase zeta catalytic subunit-like n=1 Tax=Octopus bimaculoides TaxID=37653 RepID=UPI00071E515F) HSP 1 Score: 56.2 bits (134), Expect = 4.500e-8 Identity = 22/29 (75.86%), Postives = 26/29 (89.66%), Query Frame = 0 Query: 29 QTPVIRIWGSTPAGQKACLHLHGIYPYFY 57 Q PVIRI+GSTPAGQK CLH+HG++PY Y Sbjct: 29 QVPVIRIFGSTPAGQKTCLHVHGVFPYLY 57
BLAST of jgi.p|Trimin1|182350 vs. uniprot
Match: A0A0L8G8L4_OCTBM (DNA_pol_B_exo1 domain-containing protein n=1 Tax=Octopus bimaculoides TaxID=37653 RepID=A0A0L8G8L4_OCTBM) HSP 1 Score: 56.2 bits (134), Expect = 5.280e-8 Identity = 22/29 (75.86%), Postives = 26/29 (89.66%), Query Frame = 0 Query: 29 QTPVIRIWGSTPAGQKACLHLHGIYPYFY 57 Q PVIRI+GSTPAGQK CLH+HG++PY Y Sbjct: 29 QVPVIRIFGSTPAGQKTCLHVHGVFPYLY 57
BLAST of jgi.p|Trimin1|182350 vs. uniprot
Match: A0A1X2HB89_SYNRA (Uncharacterized protein n=1 Tax=Syncephalastrum racemosum TaxID=13706 RepID=A0A1X2HB89_SYNRA) HSP 1 Score: 56.6 bits (135), Expect = 6.800e-8 Identity = 25/35 (71.43%), Postives = 28/35 (80.00%), Query Frame = 0 Query: 23 STSKQPQTPVIRIWGSTPAGQKACLHLHGIYPYFY 57 ST + PVIRI+GSTPAGQKACLH+H YPYFY Sbjct: 48 STEPLTKVPVIRIFGSTPAGQKACLHIHQAYPYFY 82
BLAST of jgi.p|Trimin1|182350 vs. uniprot
Match: A0A6G0XLP9_9STRA (DNA polymerase n=1 Tax=Aphanomyces euteiches TaxID=100861 RepID=A0A6G0XLP9_9STRA) HSP 1 Score: 56.6 bits (135), Expect = 6.810e-8 Identity = 21/29 (72.41%), Postives = 27/29 (93.10%), Query Frame = 0 Query: 29 QTPVIRIWGSTPAGQKACLHLHGIYPYFY 57 + PV+RI+G+TPAGQK C+H+HGIYPYFY Sbjct: 40 KVPVVRIFGATPAGQKCCVHIHGIYPYFY 68
BLAST of jgi.p|Trimin1|182350 vs. uniprot
Match: A0A6I8PC21_ORNAN (DNA polymerase zeta catalytic subunit n=2 Tax=Ornithorhynchus anatinus TaxID=9258 RepID=A0A6I8PC21_ORNAN) HSP 1 Score: 56.6 bits (135), Expect = 6.840e-8 Identity = 21/30 (70.00%), Postives = 27/30 (90.00%), Query Frame = 0 Query: 28 PQTPVIRIWGSTPAGQKACLHLHGIYPYFY 57 P+ PV+R++G+TPAGQK CLHLHGI+PY Y Sbjct: 33 PKVPVVRVFGATPAGQKTCLHLHGIFPYLY 62
BLAST of jgi.p|Trimin1|182350 vs. uniprot
Match: A8IZI7_CHLRE (Predicted protein n=1 Tax=Chlamydomonas reinhardtii TaxID=3055 RepID=A8IZI7_CHLRE) HSP 1 Score: 54.3 bits (129), Expect = 8.720e-8 Identity = 22/29 (75.86%), Postives = 26/29 (89.66%), Query Frame = 0 Query: 29 QTPVIRIWGSTPAGQKACLHLHGIYPYFY 57 Q PVIRI+GSTPAGQKAC+H+H +PYFY Sbjct: 41 QVPVIRIFGSTPAGQKACVHVHRAFPYFY 69 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|182350 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Trimin1|182350|e_gw1.437.4.1 ID=Trimin1|182350|e_gw1.437.4.1|Name=jgi.p|Trimin1|182350|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=57bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|