Trimin1|179148|e_gw1.185.19.1 (polypeptide) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|179148 vs. uniprot
Match: A0A835Z5Y8_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z5Y8_9STRA) HSP 1 Score: 115 bits (288), Expect = 2.470e-25 Identity = 56/56 (100.00%), Postives = 56/56 (100.00%), Query Frame = 0 Query: 1 MLRTAIRATDDGFQADALPLVRPLAPTKRAASLPDDFGALSALTDCDLHGCEYLTR 56 MLRTAIRATDDGFQADALPLVRPLAPTKRAASLPDDFGALSALTDCDLHGCEYLTR Sbjct: 1 MLRTAIRATDDGFQADALPLVRPLAPTKRAASLPDDFGALSALTDCDLHGCEYLTR 56
BLAST of jgi.p|Trimin1|179148 vs. uniprot
Match: A0A836CKU4_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CKU4_9STRA) HSP 1 Score: 107 bits (268), Expect = 8.040e-23 Identity = 52/55 (94.55%), Postives = 54/55 (98.18%), Query Frame = 0 Query: 1 MLRTAIRATDDGFQADALPLVRPLAPTKRAASLPDDFGALSALTDCDLHGCEYLT 55 MLRTAIRATDDGFQADALPLVR LAP++RAASLPDDFGALSALTDCDLHGCEYLT Sbjct: 1 MLRTAIRATDDGFQADALPLVRSLAPSRRAASLPDDFGALSALTDCDLHGCEYLT 55
BLAST of jgi.p|Trimin1|179148 vs. uniprot
Match: A0A835YQD9_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YQD9_9STRA) HSP 1 Score: 69.7 bits (169), Expect = 3.070e-9 Identity = 36/54 (66.67%), Postives = 39/54 (72.22%), Query Frame = 0 Query: 1 MLRTAIRATDDGFQADALPLVRPLAPTKRAASLPDDFGALSALTDCDLHGCEYL 54 MLRTAIRATD GFQADAL LV+ L P +R SLPDD LSALT D+ CE L Sbjct: 1 MLRTAIRATDTGFQADALSLVQSLVPNERVTSLPDDISVLSALTAVDVSSCEKL 54
BLAST of jgi.p|Trimin1|179148 vs. uniprot
Match: A0A835ZFG8_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZFG8_9STRA) HSP 1 Score: 62.8 bits (151), Expect = 3.560e-7 Identity = 34/55 (61.82%), Postives = 39/55 (70.91%), Query Frame = 0 Query: 1 MLRTAIRATDDGFQADALPLVRPLAPTKRAASLPDDFGALSALTDCDLHGCEYLT 55 MLRTA+RAT GFQADAL LV + R ASLPD+ GALSA+T L GC+ LT Sbjct: 161 MLRTAVRATGAGFQADALALVHSFTLSDRVASLPDEVGALSAVTVVVLSGCDRLT 215 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|179148 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Trimin1|179148|e_gw1.185.19.1 ID=Trimin1|179148|e_gw1.185.19.1|Name=jgi.p|Trimin1|179148|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=377bpback to top |