Trimin1|149423|gw1.65.81.1 (polypeptide) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|149423 vs. uniprot
Match: A0A835YVJ7_9STRA (60S ribosomal protein L29 (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YVJ7_9STRA) HSP 1 Score: 104 bits (259), Expect = 1.620e-28 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 0 Query: 1 LQQKNHTGRNASAKDHANGIKKAPRFKYNSLKGMDPKFLRNQRYAKKKNPRK 52 LQQKNHTGRNASAKDHANGIKKAPRFKYNSLKGMDPKFLRNQRYAKKKNPRK Sbjct: 1 LQQKNHTGRNASAKDHANGIKKAPRFKYNSLKGMDPKFLRNQRYAKKKNPRK 52
BLAST of jgi.p|Trimin1|149423 vs. uniprot
Match: D8LU40_ECTSI (60S ribosomal protein L29 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LU40_ECTSI) HSP 1 Score: 76.3 bits (186), Expect = 2.690e-17 Identity = 36/49 (73.47%), Postives = 43/49 (87.76%), Query Frame = 0 Query: 1 LQQKNHTGRNASAKDHANGIKKAPRFKYNSLKGMDPKFLRNQRYAKKKN 49 ++QK+HTGRNA+ KDH NGIKKAP KY S+KGMDPKFLRNQ++AKK N Sbjct: 2 VKQKHHTGRNATFKDHVNGIKKAPNHKYKSMKGMDPKFLRNQKFAKKYN 50
BLAST of jgi.p|Trimin1|149423 vs. uniprot
Match: A0A2P6TDJ6_CHLSO (60S ribosomal protein L29 n=1 Tax=Chlorella sorokiniana TaxID=3076 RepID=A0A2P6TDJ6_CHLSO) HSP 1 Score: 65.1 bits (157), Expect = 6.350e-13 Identity = 33/44 (75.00%), Postives = 35/44 (79.55%), Query Frame = 0 Query: 4 KNHTGRNASAKDHANGIKKAPRFKYNSLKGMDPKFLRNQRYAKK 47 KNHT N SAK H NGIKK R +Y+S KGMDPKFLRNQRYAKK Sbjct: 5 KNHTAANQSAKAHKNGIKKPQRQRYSSRKGMDPKFLRNQRYAKK 48
BLAST of jgi.p|Trimin1|149423 vs. uniprot
Match: A0A7I4A457_PHYPA (60S ribosomal protein L29 n=4 Tax=Physcomitrium patens TaxID=3218 RepID=A0A7I4A457_PHYPA) HSP 1 Score: 65.5 bits (158), Expect = 8.050e-13 Identity = 33/46 (71.74%), Postives = 35/46 (76.09%), Query Frame = 0 Query: 4 KNHTGRNASAKDHANGIKKAPRFKYNSLKGMDPKFLRNQRYAKKKN 49 KNHT N S K+H NGIKK + KY S KGMDPKFLRNQRYAKK N Sbjct: 20 KNHTAHNQSYKNHKNGIKKVKKHKYASRKGMDPKFLRNQRYAKKHN 65
BLAST of jgi.p|Trimin1|149423 vs. uniprot
Match: A0A2K1JGS4_PHYPA (60S ribosomal protein L29 n=2 Tax=Physcomitrium patens TaxID=3218 RepID=A0A2K1JGS4_PHYPA) HSP 1 Score: 65.1 bits (157), Expect = 9.600e-13 Identity = 33/46 (71.74%), Postives = 35/46 (76.09%), Query Frame = 0 Query: 4 KNHTGRNASAKDHANGIKKAPRFKYNSLKGMDPKFLRNQRYAKKKN 49 KNHT N S K+H NGIKK + KY S KGMDPKFLRNQRYAKK N Sbjct: 13 KNHTAHNQSYKNHKNGIKKVKKHKYISRKGMDPKFLRNQRYAKKHN 58
BLAST of jgi.p|Trimin1|149423 vs. uniprot
Match: A0A5B8MJV1_9CHLO (60S ribosomal protein L29 n=1 Tax=Chloropicon primus TaxID=1764295 RepID=A0A5B8MJV1_9CHLO) HSP 1 Score: 64.3 bits (155), Expect = 1.280e-12 Identity = 32/46 (69.57%), Postives = 35/46 (76.09%), Query Frame = 0 Query: 4 KNHTGRNASAKDHANGIKKAPRFKYNSLKGMDPKFLRNQRYAKKKN 49 KNHT N S K+H NGIKK + KY+S KGMDPKFLRNQRY KK N Sbjct: 5 KNHTAHNQSYKNHRNGIKKQKKQKYSSTKGMDPKFLRNQRYCKKHN 50
BLAST of jgi.p|Trimin1|149423 vs. uniprot
Match: V4LZQ9_EUTSA (60S ribosomal protein L29 n=1 Tax=Eutrema salsugineum TaxID=72664 RepID=V4LZQ9_EUTSA) HSP 1 Score: 63.9 bits (154), Expect = 2.150e-12 Identity = 32/46 (69.57%), Postives = 35/46 (76.09%), Query Frame = 0 Query: 4 KNHTGRNASAKDHANGIKKAPRFKYNSLKGMDPKFLRNQRYAKKKN 49 KNHT N SAK H NGIKK R ++ S KGMDPKFLRNQRYA+K N Sbjct: 5 KNHTAHNQSAKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHN 50
BLAST of jgi.p|Trimin1|149423 vs. uniprot
Match: A0A067C325_SAPPC (60S ribosomal protein L29 n=4 Tax=Saprolegniaceae TaxID=4764 RepID=A0A067C325_SAPPC) HSP 1 Score: 63.5 bits (153), Expect = 2.980e-12 Identity = 30/49 (61.22%), Postives = 39/49 (79.59%), Query Frame = 0 Query: 1 LQQKNHTGRNASAKDHANGIKKAPRFKYNSLKGMDPKFLRNQRYAKKKN 49 ++QKNHT RN + K H NGI+K + +Y+S KG+DPKFLRNQR+AKK N Sbjct: 2 VKQKNHTARNQTVKAHKNGIRKPHKHRYHSTKGLDPKFLRNQRFAKKYN 50
BLAST of jgi.p|Trimin1|149423 vs. uniprot
Match: U9SIP6_RHIID (60S ribosomal protein L29 n=4 Tax=Glomeraceae TaxID=36751 RepID=U9SIP6_RHIID) HSP 1 Score: 63.5 bits (153), Expect = 3.370e-12 Identity = 31/45 (68.89%), Postives = 35/45 (77.78%), Query Frame = 0 Query: 4 KNHTGRNASAKDHANGIKKAPRFKYNSLKGMDPKFLRNQRYAKKK 48 KNHT N + K H NGIKK ++Y SLKG+DPKFLRNQRYAKKK Sbjct: 5 KNHTNHNQNRKAHRNGIKKPKTYRYPSLKGVDPKFLRNQRYAKKK 49
BLAST of jgi.p|Trimin1|149423 vs. uniprot
Match: D8TVB8_VOLCA (60S ribosomal protein L29 n=1 Tax=Volvox carteri f. nagariensis TaxID=3068 RepID=D8TVB8_VOLCA) HSP 1 Score: 63.2 bits (152), Expect = 3.680e-12 Identity = 32/46 (69.57%), Postives = 34/46 (73.91%), Query Frame = 0 Query: 4 KNHTGRNASAKDHANGIKKAPRFKYNSLKGMDPKFLRNQRYAKKKN 49 KNHT N + K H NGIKK + KY S KGMDPKFLRNQRYAKK N Sbjct: 5 KNHTAHNQNRKAHRNGIKKPQKHKYASRKGMDPKFLRNQRYAKKHN 50 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|149423 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Trimin1|149423|gw1.65.81.1 ID=Trimin1|149423|gw1.65.81.1|Name=jgi.p|Trimin1|149423|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=52bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|