Trimin1|11657|CE11656_12 (polypeptide) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|11657 vs. uniprot
Match: A0A835ZC50_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZC50_9STRA) HSP 1 Score: 74.3 bits (181), Expect = 1.350e-15 Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 0 Query: 1 MINPAEGAALNGHVSVLKWLKARGLFRNELVLESAA 36 MINPAEGAALNGHVSVLKWLKARGLFRNELVLESAA Sbjct: 1 MINPAEGAALNGHVSVLKWLKARGLFRNELVLESAA 36
BLAST of jgi.p|Trimin1|11657 vs. uniprot
Match: A0A835ZLA1_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZLA1_9STRA) HSP 1 Score: 54.7 bits (130), Expect = 1.150e-6 Identity = 26/34 (76.47%), Postives = 28/34 (82.35%), Query Frame = 0 Query: 3 NPAEGAALNGHVSVLKWLKARGLFRNELVLESAA 36 NPA GAA GH+SVLKWLKA GLFR + VLESAA Sbjct: 630 NPAAGAARRGHMSVLKWLKAHGLFRKKQVLESAA 663 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|11657 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Trimin1|11657|CE11656_12 ID=Trimin1|11657|CE11656_12|Name=jgi.p|Trimin1|11657|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=88bpback to top |