mRNA_11930 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|149960 vs. uniprot
Match: A0A835ZGH9_9STRA (Uncharacterized protein (Fragment) n=2 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZGH9_9STRA) HSP 1 Score: 96.7 bits (239), Expect = 8.890e-21 Identity = 40/40 (100.00%), Postives = 40/40 (100.00%), Query Frame = 1 Query: 1 CREHKTGDMQDVSHKRCMQCRLKIPKFGTEDGRPTHCGDC 120 CREHKTGDMQDVSHKRCMQCRLKIPKFGTEDGRPTHCGDC Sbjct: 1 CREHKTGDMQDVSHKRCMQCRLKIPKFGTEDGRPTHCGDC 40
BLAST of jgi.p|Trimin1|149960 vs. uniprot
Match: A0A835ZBE1_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZBE1_9STRA) HSP 1 Score: 80.1 bits (196), Expect = 1.030e-13 Identity = 33/36 (91.67%), Postives = 35/36 (97.22%), Query Frame = 1 Query: 1 CREHKTGDMQDVSHKRCMQCRLKIPKFGTEDGRPTH 108 CREHKTGDMQDV+HKRCM+C LKIPKFGTEDGRPTH Sbjct: 372 CREHKTGDMQDVAHKRCMRCGLKIPKFGTEDGRPTH 407
BLAST of jgi.p|Trimin1|149960 vs. uniprot
Match: A0A836CCS5_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CCS5_9STRA) HSP 1 Score: 63.5 bits (153), Expect = 1.830e-8 Identity = 26/36 (72.22%), Postives = 28/36 (77.78%), Query Frame = 1 Query: 1 CREHKTGDMQDVSHKRCMQCRLKIPKFGTEDGRPTH 108 C +HKTGDMQDV+HK C C LKIP FG EDG PTH Sbjct: 15 CSDHKTGDMQDVAHKMCQGCGLKIPIFGIEDGSPTH 50 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|149960 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_11930 ID=mRNA_11930|Name=jgi.p|Trimin1|149960|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=699bp|location=Sequence derived from alignment at Contig_111:504995..505693- (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. TGCAGGGAGCACAAGACTGGAGACATGCAAGATGTGTCACACAAGAGGTGback to top protein sequence of jgi.p|Trimin1|149960 >Trimin1|149960|gw1.111.82.1 ID=Trimin1|149960|gw1.111.82.1|Name=jgi.p|Trimin1|149960|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=233bp CREHKTGDMQDVSHKRCMQCRLKIPKFGTEDGRPTHCGDCKTADMRDVGNback to top mRNA from alignment at Contig_111:504995..505693- Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_11930 ID=mRNA_11930|Name=jgi.p|Trimin1|149960|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=699bp|location=Sequence derived from alignment at Contig_111:504995..505693- (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_111:504995..505693- >mRNA_11930 ID=mRNA_11930|Name=jgi.p|Trimin1|149960|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=699bp|location=Sequence derived from alignment at Contig_111:504995..505693- (Tribonema minus UTEX_B_3156 )back to top |