mRNA_11251 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|129470 vs. uniprot
Match: A0A835ZE41_9STRA (RWP-RK domain-containing protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZE41_9STRA) HSP 1 Score: 106 bits (264), Expect = 2.790e-29 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 1 Query: 1 RASSLTLADLERYYSHPLAEASRELGLSATMLKKVCRSFGIKRWPHRQLASI 156 RASSLTLADLERYYSHPLAEASRELGLSATMLKKVCRSFGIKRWPHRQLASI Sbjct: 1 RASSLTLADLERYYSHPLAEASRELGLSATMLKKVCRSFGIKRWPHRQLASI 52
BLAST of jgi.p|Trimin1|129470 vs. uniprot
Match: A0A836CH06_9STRA (RWP-RK domain-containing protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CH06_9STRA) HSP 1 Score: 76.6 bits (187), Expect = 2.840e-17 Identity = 34/51 (66.67%), Postives = 43/51 (84.31%), Query Frame = 1 Query: 4 ASSLTLADLERYYSHPLAEASRELGLSATMLKKVCRSFGIKRWPHRQLASI 156 + +TL +ERYY+ PLA+A+R LGLSATMLKKVCRS G++ WP+RQLASI Sbjct: 25 SKDITLPQVERYYNQPLAQAARGLGLSATMLKKVCRSLGVRNWPYRQLASI 75
BLAST of jgi.p|Trimin1|129470 vs. uniprot
Match: A0A835YTG3_9STRA (Putative NIN-like transcription factor n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YTG3_9STRA) HSP 1 Score: 71.6 bits (174), Expect = 2.280e-13 Identity = 31/51 (60.78%), Postives = 41/51 (80.39%), Query Frame = 1 Query: 4 ASSLTLADLERYYSHPLAEASRELGLSATMLKKVCRSFGIKRWPHRQLASI 156 A +TL L+ YY+ PLAE ++ELGLS T+LKK+CR FGI+RWPHRQ+ S+ Sbjct: 8 ADQITLELLQSYYNVPLAELAKELGLSLTLLKKICRKFGIQRWPHRQIRSL 58
BLAST of jgi.p|Trimin1|129470 vs. uniprot
Match: H6WBB7_VAULI (Putative NIN-like transcription factor n=1 Tax=Vaucheria litorea TaxID=109269 RepID=H6WBB7_VAULI) HSP 1 Score: 70.9 bits (172), Expect = 4.170e-13 Identity = 31/48 (64.58%), Postives = 40/48 (83.33%), Query Frame = 1 Query: 13 LTLADLERYYSHPLAEASRELGLSATMLKKVCRSFGIKRWPHRQLASI 156 +TL L+ YY+ PLAE ++ELGLS T+LKK+CR FGI+RWPHRQ+ SI Sbjct: 14 ITLELLQSYYNVPLAELAKELGLSLTLLKKICRKFGIQRWPHRQIRSI 61
BLAST of jgi.p|Trimin1|129470 vs. uniprot
Match: A0A835Z1M5_9STRA (Putative NIN-like transcription factor n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z1M5_9STRA) HSP 1 Score: 70.1 bits (170), Expect = 8.480e-13 Identity = 30/51 (58.82%), Postives = 42/51 (82.35%), Query Frame = 1 Query: 4 ASSLTLADLERYYSHPLAEASRELGLSATMLKKVCRSFGIKRWPHRQLASI 156 A ++TL L+ +Y+ PLAE ++ELGLS T+LKK+CR +GI+RWPHRQ+ SI Sbjct: 11 ADNITLELLQSFYNVPLAELAKELGLSLTLLKKICRKYGIQRWPHRQIRSI 61
BLAST of jgi.p|Trimin1|129470 vs. uniprot
Match: D8R0I0_SELML (RWP-RK domain-containing protein (Fragment) n=3 Tax=Selaginella moellendorffii TaxID=88036 RepID=D8R0I0_SELML) HSP 1 Score: 63.5 bits (153), Expect = 3.720e-12 Identity = 27/52 (51.92%), Postives = 38/52 (73.08%), Query Frame = 1 Query: 1 RASSLTLADLERYYSHPLAEASRELGLSATMLKKVCRSFGIKRWPHRQLASI 156 R ++L DL RY++ P+ +AS+EL + T+LKK CR FGI RWPHR+L S+ Sbjct: 12 RMMDISLEDLSRYFTMPITQASKELKVGLTVLKKRCREFGIPRWPHRKLKSL 63
BLAST of jgi.p|Trimin1|129470 vs. uniprot
Match: D8RII7_SELML (RWP-RK domain-containing protein (Fragment) n=5 Tax=Selaginella moellendorffii TaxID=88036 RepID=D8RII7_SELML) HSP 1 Score: 62.8 bits (151), Expect = 5.880e-12 Identity = 27/52 (51.92%), Postives = 37/52 (71.15%), Query Frame = 1 Query: 1 RASSLTLADLERYYSHPLAEASRELGLSATMLKKVCRSFGIKRWPHRQLASI 156 R ++L DL RY++ P+ +AS EL + T+LKK CR FGI RWPHR+L S+ Sbjct: 2 RMMDISLEDLSRYFTMPITQASNELKVGLTVLKKWCREFGIPRWPHRKLKSL 53
BLAST of jgi.p|Trimin1|129470 vs. uniprot
Match: A0A835Z7T4_9STRA (RWP-RK domain-containing protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z7T4_9STRA) HSP 1 Score: 64.3 bits (155), Expect = 6.120e-12 Identity = 29/51 (56.86%), Postives = 39/51 (76.47%), Query Frame = 1 Query: 4 ASSLTLADLERYYSHPLAEASRELGLSATMLKKVCRSFGIKRWPHRQLASI 156 A L ++ LE +Y PL A+REL +S TMLKK+CR +GIKRWPHRQ++S+ Sbjct: 10 AKRLPVSVLEEFYHVPLNIAARELSVSLTMLKKLCRQYGIKRWPHRQVSSL 60
BLAST of jgi.p|Trimin1|129470 vs. uniprot
Match: A0A061G426_THECC (RWP-RK domain-containing protein n=4 Tax=Byttnerioideae TaxID=214909 RepID=A0A061G426_THECC) HSP 1 Score: 67.0 bits (162), Expect = 1.050e-11 Identity = 27/52 (51.92%), Postives = 40/52 (76.92%), Query Frame = 1 Query: 1 RASSLTLADLERYYSHPLAEASRELGLSATMLKKVCRSFGIKRWPHRQLASI 156 R +LTL D+E+Y+ P+ EA+R L LS T+LKK+CR +G+ RWPHR++ S+ Sbjct: 268 RTRNLTLKDIEKYFHLPIEEAARRLDLSVTVLKKICRKYGVLRWPHRKIQSM 319
BLAST of jgi.p|Trimin1|129470 vs. uniprot
Match: D8LJT6_ECTSI (Putative NIN-like transcription factor n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJT6_ECTSI) HSP 1 Score: 67.0 bits (162), Expect = 1.170e-11 Identity = 25/48 (52.08%), Postives = 40/48 (83.33%), Query Frame = 1 Query: 13 LTLADLERYYSHPLAEASRELGLSATMLKKVCRSFGIKRWPHRQLASI 156 +TL DLERY+ +P+ E S+ +G+S T++K++CR +GIKRWP+RQ+ S+ Sbjct: 106 VTLRDLERYFEYPIEEVSKMMGVSTTIIKRLCRKYGIKRWPYRQIRSV 153 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|129470 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_11251 ID=mRNA_11251|Name=jgi.p|Trimin1|129470|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=156bp|location=Sequence derived from alignment at Contig_116:46013..46168- (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. CGCGCGAGCTCCCTCACGCTGGCGGACTTGGAGCGCTACTACTCGCACCCback to top protein sequence of jgi.p|Trimin1|129470 >Trimin1|129470|gw1.116.1.1 ID=Trimin1|129470|gw1.116.1.1|Name=jgi.p|Trimin1|129470|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=52bp RASSLTLADLERYYSHPLAEASRELGLSATMLKKVCRSFGIKRWPHRQLAback to top mRNA from alignment at Contig_116:46013..46168- Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_11251 ID=mRNA_11251|Name=jgi.p|Trimin1|129470|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=156bp|location=Sequence derived from alignment at Contig_116:46013..46168- (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_116:46013..46168- >mRNA_11251 ID=mRNA_11251|Name=jgi.p|Trimin1|129470|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=156bp|location=Sequence derived from alignment at Contig_116:46013..46168- (Tribonema minus UTEX_B_3156 )back to top |