mRNA_S-firma_F_contig1000.58.1 (mRNA) Sphaerotrichia firma ET2_F female
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_S-firma_F_contig1000.58.1 vs. uniprot
Match: A0A6H5KBF2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KBF2_9PHAE) HSP 1 Score: 66.2 bits (160), Expect = 8.420e-10 Identity = 31/46 (67.39%), Postives = 36/46 (78.26%), Query Frame = 1 Query: 145 AEEGRRMPWAGVEDLKRSRRAHRERLEELLSACVGAMPFEPRGGGW 282 A++G + WAG L+RSR A+RERLE LLSACV AMP EPRGGGW Sbjct: 1000 ADKGTGVEWAGSSALERSRVANRERLESLLSACVEAMPLEPRGGGW 1045 The following BLAST results are available for this feature:
BLAST of mRNA_S-firma_F_contig1000.58.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Sphaerotrichia firma female vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_S-firma_F_contig1000.58.1 >prot_S-firma_F_contig1000.58.1 ID=prot_S-firma_F_contig1000.58.1|Name=mRNA_S-firma_F_contig1000.58.1|organism=Sphaerotrichia firma ET2_F female|type=polypeptide|length=41bp MPWAGVEDLKRSRRAHRERLEELLSACVGAMPFEPRGGGW*back to top mRNA from alignment at S-firma_F_contig1000:3044..3493+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_S-firma_F_contig1000.58.1 ID=mRNA_S-firma_F_contig1000.58.1|Name=mRNA_S-firma_F_contig1000.58.1|organism=Sphaerotrichia firma ET2_F female|type=mRNA|length=450bp|location=Sequence derived from alignment at S-firma_F_contig1000:3044..3493+ (Sphaerotrichia firma ET2_F female)back to top Coding sequence (CDS) from alignment at S-firma_F_contig1000:3044..3493+ >mRNA_S-firma_F_contig1000.58.1 ID=mRNA_S-firma_F_contig1000.58.1|Name=mRNA_S-firma_F_contig1000.58.1|organism=Sphaerotrichia firma ET2_F female|type=CDS|length=246bp|location=Sequence derived from alignment at S-firma_F_contig1000:3044..3493+ (Sphaerotrichia firma ET2_F female)back to top |