prot_P-wetherbeei_contig1004.2.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1004.2.1 vs. uniprot
Match: A0A6H5KJI9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KJI9_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 1.090e-11 Identity = 37/81 (45.68%), Postives = 45/81 (55.56%), Query Frame = 0 Query: 1 LALDSRWRTSALQRGAVTHATLRSRWSQASRARVAEHWEDYWCHSVSPVFFGRSA---------RPRRTKEEAAVARAAAT 72 +AL + S L G +TH +RW ASR R+ WE YWCHS+SPVFFGRS RR +EE A A+ AAT Sbjct: 695 IALQAAKEGSELLSGGLTHTVTSARWCPASRCRLLSTWEGYWCHSISPVFFGRSVLGRRITKDMARRRQEEEVATAQLAAT 775
BLAST of mRNA_P-wetherbeei_contig1004.2.1 vs. uniprot
Match: D7G5G5_ECTSI (Serine/threonine-protein kinase Nek3 (NimA-related protein kinase 3) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G5G5_ECTSI) HSP 1 Score: 67.4 bits (163), Expect = 2.040e-11 Identity = 37/81 (45.68%), Postives = 45/81 (55.56%), Query Frame = 0 Query: 1 LALDSRWRTSALQRGAVTHATLRSRWSQASRARVAEHWEDYWCHSVSPVFFGRSA---------RPRRTKEEAAVARAAAT 72 +AL + S L G +TH +RW SR RV WE YWCHS+SPVFFGRS RR +E+AA A+ AAT Sbjct: 276 IALQAAREGSELLSGGLTHTVTSARWCPTSRGRVLSTWEGYWCHSLSPVFFGRSVLGRHMTKEMARRRQEEDAAAAQLAAT 356 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1004.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig1004.2.1 ID=prot_P-wetherbeei_contig1004.2.1|Name=mRNA_P-wetherbeei_contig1004.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=72bpback to top |