mRNA_P-wetherbeei_contig1004.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1004.2.1 vs. uniprot
Match: A0A6H5KJI9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KJI9_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 1.090e-11 Identity = 37/81 (45.68%), Postives = 45/81 (55.56%), Query Frame = 1 Query: 1 LALDSRWRTSALQRGAVTHATLRSRWSQASRARVAEHWEDYWCHSVSPVFFGRSA---------RPRRTKEEAAVARAAAT 216 +AL + S L G +TH +RW ASR R+ WE YWCHS+SPVFFGRS RR +EE A A+ AAT Sbjct: 695 IALQAAKEGSELLSGGLTHTVTSARWCPASRCRLLSTWEGYWCHSISPVFFGRSVLGRRITKDMARRRQEEEVATAQLAAT 775
BLAST of mRNA_P-wetherbeei_contig1004.2.1 vs. uniprot
Match: D7G5G5_ECTSI (Serine/threonine-protein kinase Nek3 (NimA-related protein kinase 3) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G5G5_ECTSI) HSP 1 Score: 67.4 bits (163), Expect = 2.040e-11 Identity = 37/81 (45.68%), Postives = 45/81 (55.56%), Query Frame = 1 Query: 1 LALDSRWRTSALQRGAVTHATLRSRWSQASRARVAEHWEDYWCHSVSPVFFGRSA---------RPRRTKEEAAVARAAAT 216 +AL + S L G +TH +RW SR RV WE YWCHS+SPVFFGRS RR +E+AA A+ AAT Sbjct: 276 IALQAAREGSELLSGGLTHTVTSARWCPTSRGRVLSTWEGYWCHSLSPVFFGRSVLGRHMTKEMARRRQEEDAAAAQLAAT 356 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1004.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig1004.2.1 >prot_P-wetherbeei_contig1004.2.1 ID=prot_P-wetherbeei_contig1004.2.1|Name=mRNA_P-wetherbeei_contig1004.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=72bp LALDSRWRTSALQRGAVTHATLRSRWSQASRARVAEHWEDYWCHSVSPVFback to top mRNA from alignment at P-wetherbeei_contig1004:7316..7531+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig1004.2.1 ID=mRNA_P-wetherbeei_contig1004.2.1|Name=mRNA_P-wetherbeei_contig1004.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=216bp|location=Sequence derived from alignment at P-wetherbeei_contig1004:7316..7531+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig1004:7316..7531+ >mRNA_P-wetherbeei_contig1004.2.1 ID=mRNA_P-wetherbeei_contig1004.2.1|Name=mRNA_P-wetherbeei_contig1004.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=216bp|location=Sequence derived from alignment at P-wetherbeei_contig1004:7316..7531+ (Phaeothamnion wetherbeei SAG_119_79)back to top |