prot_P-wetherbeei_contig9634.2.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Match: A0A4D9D0F3_9STRA (Thioredoxin domain-containing protein n=2 Tax=Monodopsidaceae TaxID=425072 RepID=A0A4D9D0F3_9STRA) HSP 1 Score: 60.8 bits (146), Expect = 2.240e-9 Identity = 30/52 (57.69%), Postives = 36/52 (69.23%), Query Frame = 0 Query: 1 MDLYQKIPKDLTEATEGGAFLSICAGAFMVLLFHIELYGFLVWRPETYVVLD 52 MDLY+++P DLTE + G LSI AG FMV LF +EL F+ R ET VVLD Sbjct: 11 MDLYRRVPADLTETSTLGGLLSIVAGVFMVALFIVELISFMSHRTETMVVLD 62
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Match: A0A8C4CY22_9TELE (Endoplasmic reticulum-Golgi intermediate compartment protein n=1 Tax=Denticeps clupeoides TaxID=299321 RepID=A0A8C4CY22_9TELE) HSP 1 Score: 52.4 bits (124), Expect = 1.270e-7 Identity = 23/41 (56.10%), Postives = 31/41 (75.61%), Query Frame = 0 Query: 1 MDLYQKIPKDLTEATEGGAFLSICAGAFMVLLFHIELYGFL 41 +D+Y+K+PKDLT+ T GAF+SIC FM+ LF EL GF+ Sbjct: 10 LDIYRKVPKDLTQPTYTGAFISICCCVFMLFLFLSELTGFI 50
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Match: UPI001924C19E (protein disulfide-isomerase 5-3-like n=1 Tax=Hibiscus syriacus TaxID=106335 RepID=UPI001924C19E) HSP 1 Score: 55.8 bits (133), Expect = 1.310e-7 Identity = 27/58 (46.55%), Postives = 40/58 (68.97%), Query Frame = 0 Query: 1 MDLYQKIPKDLTEATEGGAFLSICAGAFMVLLFHIELYGFLVWRPETYVVLDDVREGK 58 +D Y+KIP+DLTEA+ GA+LSI A MVLLF +EL +L T +++D+ +G+ Sbjct: 10 VDFYRKIPRDLTEASVLGAWLSIVAAVSMVLLFGMELNNYLTVSTSTSIIVDNSSDGE 67
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Match: A0A5A9NGI1_9TELE (Endoplasmic reticulum-Golgi intermediate compartment protein n=7 Tax=Clupeocephala TaxID=186625 RepID=A0A5A9NGI1_9TELE) HSP 1 Score: 54.7 bits (130), Expect = 3.020e-7 Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 0 Query: 1 MDLYQKIPKDLTEATEGGAFLSICAGAFMVLLFHIELYGFLVWRPETYVVLDD 53 +D+Y+K+PKDLT+ T GAF+SIC FM+ LF EL GF+ + +DD Sbjct: 13 LDIYRKVPKDLTQPTYTGAFISICCCIFMMFLFLSELTGFITTEIVNELYVDD 65
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Match: A0A3B3S447_9TELE (Endoplasmic reticulum-Golgi intermediate compartment protein n=11 Tax=Actinopterygii TaxID=7898 RepID=A0A3B3S447_9TELE) HSP 1 Score: 54.7 bits (130), Expect = 3.190e-7 Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 0 Query: 1 MDLYQKIPKDLTEATEGGAFLSICAGAFMVLLFHIELYGFLVWRPETYVVLDD 53 +D+Y+K+PKDLT+ T GAF+SIC FM+ LF EL GF+ + +DD Sbjct: 41 LDIYRKVPKDLTQPTYTGAFISICCCLFMLFLFLSELTGFIATEIVNELYVDD 93
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Match: D8LK23_ECTSI (DEAD box helicase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LK23_ECTSI) HSP 1 Score: 54.7 bits (130), Expect = 3.390e-7 Identity = 26/58 (44.83%), Postives = 38/58 (65.52%), Query Frame = 0 Query: 1 MDLYQKIPKDLTEATEGGAFLSICAGAFMVLLFHIELYGFLVWRPETYVVLDDVREGK 58 +DLY KIP DL+++T G + S G M+LLF +EL+ F+ E+ VV+D+V E K Sbjct: 411 LDLYPKIPTDLSQSTAVGGWFSTLTGVIMLLLFQVELFSFMSAPIESQVVVDNVLETK 468
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Match: W5N2D2_LEPOC (Endoplasmic reticulum-Golgi intermediate compartment protein n=32 Tax=Euteleostomi TaxID=117571 RepID=W5N2D2_LEPOC) HSP 1 Score: 54.3 bits (129), Expect = 4.100e-7 Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 0 Query: 2 DLYQKIPKDLTEATEGGAFLSICAGAFMVLLFHIELYGFLVWRPETYVVLDD 53 D+Y+K+PKDLT+ T GAF+SIC FM+ LF EL GF+ + +DD Sbjct: 9 DIYRKVPKDLTQPTYTGAFISICCCVFMLFLFLSELTGFIATEIVNELYVDD 60
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Match: ERGI1_DANRE (Endoplasmic reticulum-Golgi intermediate compartment protein 1 n=147 Tax=Osteoglossocephalai TaxID=1489341 RepID=ERGI1_DANRE) HSP 1 Score: 54.3 bits (129), Expect = 4.100e-7 Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 0 Query: 2 DLYQKIPKDLTEATEGGAFLSICAGAFMVLLFHIELYGFLVWRPETYVVLDD 53 D+Y+K+PKDLT+ T GAF+SIC FM+ LF EL GF+ + +DD Sbjct: 9 DIYRKVPKDLTQPTYTGAFISICCCVFMLFLFLSELTGFIATEIVNELYVDD 60
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Match: A0A4W4EZH0_ELEEL (Endoplasmic reticulum-Golgi intermediate compartment protein n=5 Tax=Characiphysae TaxID=186628 RepID=A0A4W4EZH0_ELEEL) HSP 1 Score: 54.3 bits (129), Expect = 4.270e-7 Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 0 Query: 2 DLYQKIPKDLTEATEGGAFLSICAGAFMVLLFHIELYGFLVWRPETYVVLDD 53 D+Y+K+PKDLT+ T GAF+SIC FM+ LF EL GF+ + +DD Sbjct: 27 DIYRKVPKDLTQPTYTGAFISICCCVFMLFLFLSELTGFIATEIVNELYVDD 78
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Match: A0A498MW07_LABRO (Endoplasmic reticulum-Golgi intermediate compartment protein n=3 Tax=Cyprinidae TaxID=7953 RepID=A0A498MW07_LABRO) HSP 1 Score: 54.3 bits (129), Expect = 4.300e-7 Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 0 Query: 2 DLYQKIPKDLTEATEGGAFLSICAGAFMVLLFHIELYGFLVWRPETYVVLDD 53 D+Y+K+PKDLT+ T GAF+SIC FM+ LF EL GF+ + +DD Sbjct: 31 DIYRKVPKDLTQPTYTGAFISICCCVFMLFLFLSELTGFIATEIVNELYVDD 82 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig9634.2.1 ID=prot_P-wetherbeei_contig9634.2.1|Name=mRNA_P-wetherbeei_contig9634.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=58bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|