mRNA_P-wetherbeei_contig9634.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Match: A0A4D9D0F3_9STRA (Thioredoxin domain-containing protein n=2 Tax=Monodopsidaceae TaxID=425072 RepID=A0A4D9D0F3_9STRA) HSP 1 Score: 61.2 bits (147), Expect = 1.780e-9 Identity = 30/54 (55.56%), Postives = 37/54 (68.52%), Query Frame = 1 Query: 1 QAMDLYQKIPKDLTEATEGGAFLSICAGAFMVLLFHIELYGFLVWRPETYVVLD 162 + MDLY+++P DLTE + G LSI AG FMV LF +EL F+ R ET VVLD Sbjct: 9 RGMDLYRRVPADLTETSTLGGLLSIVAGVFMVALFIVELISFMSHRTETMVVLD 62
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Match: UPI001924C19E (protein disulfide-isomerase 5-3-like n=1 Tax=Hibiscus syriacus TaxID=106335 RepID=UPI001924C19E) HSP 1 Score: 56.6 bits (135), Expect = 7.610e-8 Identity = 27/60 (45.00%), Postives = 42/60 (70.00%), Query Frame = 1 Query: 1 QAMDLYQKIPKDLTEATEGGAFLSICAGAFMVLLFHIELYGFLVWRPETYVVLDDVREGK 180 +++D Y+KIP+DLTEA+ GA+LSI A MVLLF +EL +L T +++D+ +G+ Sbjct: 8 KSVDFYRKIPRDLTEASVLGAWLSIVAAVSMVLLFGMELNNYLTVSTSTSIIVDNSSDGE 67
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Match: A0A8C4CY22_9TELE (Endoplasmic reticulum-Golgi intermediate compartment protein n=1 Tax=Denticeps clupeoides TaxID=299321 RepID=A0A8C4CY22_9TELE) HSP 1 Score: 52.8 bits (125), Expect = 9.680e-8 Identity = 23/43 (53.49%), Postives = 32/43 (74.42%), Query Frame = 1 Query: 1 QAMDLYQKIPKDLTEATEGGAFLSICAGAFMVLLFHIELYGFL 129 + +D+Y+K+PKDLT+ T GAF+SIC FM+ LF EL GF+ Sbjct: 8 RGLDIYRKVPKDLTQPTYTGAFISICCCVFMLFLFLSELTGFI 50
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Match: UPI0018F5BE0A (endoplasmic reticulum-Golgi intermediate compartment protein 1 isoform X2 n=1 Tax=Scyliorhinus canicula TaxID=7830 RepID=UPI0018F5BE0A) HSP 1 Score: 55.5 bits (132), Expect = 1.810e-7 Identity = 25/55 (45.45%), Postives = 36/55 (65.45%), Query Frame = 1 Query: 1 QAMDLYQKIPKDLTEATEGGAFLSICAGAFMVLLFHIELYGFLVWRPETYVVLDD 165 Q +D+Y+K+P+DLT+ T GAF+SIC FM+ LF EL GF+ + +DD Sbjct: 31 QRLDIYRKVPRDLTQPTYTGAFISICCCVFMLFLFLSELTGFITTEIVNELYVDD 85
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Match: A0A5A9NGI1_9TELE (Endoplasmic reticulum-Golgi intermediate compartment protein n=7 Tax=Clupeocephala TaxID=186625 RepID=A0A5A9NGI1_9TELE) HSP 1 Score: 54.7 bits (130), Expect = 3.280e-7 Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 1 Query: 7 MDLYQKIPKDLTEATEGGAFLSICAGAFMVLLFHIELYGFLVWRPETYVVLDD 165 +D+Y+K+PKDLT+ T GAF+SIC FM+ LF EL GF+ + +DD Sbjct: 13 LDIYRKVPKDLTQPTYTGAFISICCCIFMMFLFLSELTGFITTEIVNELYVDD 65
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Match: A0A3B3S447_9TELE (Endoplasmic reticulum-Golgi intermediate compartment protein n=11 Tax=Actinopterygii TaxID=7898 RepID=A0A3B3S447_9TELE) HSP 1 Score: 54.7 bits (130), Expect = 3.460e-7 Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 1 Query: 7 MDLYQKIPKDLTEATEGGAFLSICAGAFMVLLFHIELYGFLVWRPETYVVLDD 165 +D+Y+K+PKDLT+ T GAF+SIC FM+ LF EL GF+ + +DD Sbjct: 41 LDIYRKVPKDLTQPTYTGAFISICCCLFMLFLFLSELTGFIATEIVNELYVDD 93
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Match: D8LK23_ECTSI (DEAD box helicase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LK23_ECTSI) HSP 1 Score: 54.7 bits (130), Expect = 3.690e-7 Identity = 26/58 (44.83%), Postives = 38/58 (65.52%), Query Frame = 1 Query: 7 MDLYQKIPKDLTEATEGGAFLSICAGAFMVLLFHIELYGFLVWRPETYVVLDDVREGK 180 +DLY KIP DL+++T G + S G M+LLF +EL+ F+ E+ VV+D+V E K Sbjct: 411 LDLYPKIPTDLSQSTAVGGWFSTLTGVIMLLLFQVELFSFMSAPIESQVVVDNVLETK 468
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Match: W5N2D2_LEPOC (Endoplasmic reticulum-Golgi intermediate compartment protein n=32 Tax=Euteleostomi TaxID=117571 RepID=W5N2D2_LEPOC) HSP 1 Score: 54.3 bits (129), Expect = 4.450e-7 Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 1 Query: 10 DLYQKIPKDLTEATEGGAFLSICAGAFMVLLFHIELYGFLVWRPETYVVLDD 165 D+Y+K+PKDLT+ T GAF+SIC FM+ LF EL GF+ + +DD Sbjct: 9 DIYRKVPKDLTQPTYTGAFISICCCVFMLFLFLSELTGFIATEIVNELYVDD 60
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Match: ERGI1_DANRE (Endoplasmic reticulum-Golgi intermediate compartment protein 1 n=147 Tax=Osteoglossocephalai TaxID=1489341 RepID=ERGI1_DANRE) HSP 1 Score: 54.3 bits (129), Expect = 4.450e-7 Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 1 Query: 10 DLYQKIPKDLTEATEGGAFLSICAGAFMVLLFHIELYGFLVWRPETYVVLDD 165 D+Y+K+PKDLT+ T GAF+SIC FM+ LF EL GF+ + +DD Sbjct: 9 DIYRKVPKDLTQPTYTGAFISICCCVFMLFLFLSELTGFIATEIVNELYVDD 60
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Match: A0A4W4EZH0_ELEEL (Endoplasmic reticulum-Golgi intermediate compartment protein n=5 Tax=Characiphysae TaxID=186628 RepID=A0A4W4EZH0_ELEEL) HSP 1 Score: 54.3 bits (129), Expect = 4.640e-7 Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 1 Query: 10 DLYQKIPKDLTEATEGGAFLSICAGAFMVLLFHIELYGFLVWRPETYVVLDD 165 D+Y+K+PKDLT+ T GAF+SIC FM+ LF EL GF+ + +DD Sbjct: 27 DIYRKVPKDLTQPTYTGAFISICCCVFMLFLFLSELTGFIATEIVNELYVDD 78 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9634.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig9634.2.1 >prot_P-wetherbeei_contig9634.2.1 ID=prot_P-wetherbeei_contig9634.2.1|Name=mRNA_P-wetherbeei_contig9634.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=58bp MDLYQKIPKDLTEATEGGAFLSICAGAFMVLLFHIELYGFLVWRPETYVVback to top mRNA from alignment at P-wetherbeei_contig9634:2029..2208+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig9634.2.1 ID=mRNA_P-wetherbeei_contig9634.2.1|Name=mRNA_P-wetherbeei_contig9634.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=180bp|location=Sequence derived from alignment at P-wetherbeei_contig9634:2029..2208+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig9634:2029..2208+ >mRNA_P-wetherbeei_contig9634.2.1 ID=mRNA_P-wetherbeei_contig9634.2.1|Name=mRNA_P-wetherbeei_contig9634.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=174bp|location=Sequence derived from alignment at P-wetherbeei_contig9634:2029..2208+ (Phaeothamnion wetherbeei SAG_119_79)back to top |