mRNA_P-wetherbeei_contig12881.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig12881.1.1 vs. uniprot
Match: A0A835Z9V2_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z9V2_9STRA) HSP 1 Score: 63.9 bits (154), Expect = 3.230e-11 Identity = 30/40 (75.00%), Postives = 36/40 (90.00%), Query Frame = 1 Query: 1 QLEEMEDKETSATSVVLLDDGTLEFGATDGPLPKSSKGTW 120 QLEE+EDKET+ATSVVL DG++ FGATDGPLPKS+ G+W Sbjct: 70 QLEELEDKETAATSVVLNGDGSVSFGATDGPLPKSTTGSW 109
BLAST of mRNA_P-wetherbeei_contig12881.1.1 vs. uniprot
Match: A0A6U0KI98_9STRA (Hypothetical protein n=1 Tax=Minutocellus polymorphus TaxID=265543 RepID=A0A6U0KI98_9STRA) HSP 1 Score: 59.3 bits (142), Expect = 1.480e-9 Identity = 28/49 (57.14%), Postives = 34/49 (69.39%), Query Frame = 1 Query: 1 QLEEMEDKETSATSVVLLDDGTLEFGATDGPLPKSSKGTWEAQGDKIMM 147 QLEE+ED++ +T V+L DDGT+ GATDGP P S GTWE GD M Sbjct: 50 QLEELEDRDDCSTEVLLKDDGTVTTGATDGPPPSESSGTWEFAGDTFKM 98
BLAST of mRNA_P-wetherbeei_contig12881.1.1 vs. uniprot
Match: A0A7S2P4Y7_9STRA (Hypothetical protein n=1 Tax=Leptocylindrus danicus TaxID=163516 RepID=A0A7S2P4Y7_9STRA) HSP 1 Score: 57.8 bits (138), Expect = 6.650e-9 Identity = 27/49 (55.10%), Postives = 33/49 (67.35%), Query Frame = 1 Query: 1 QLEEMEDKETSATSVVLLDDGTLEFGATDGPLPKSSKGTWEAQGDKIMM 147 QLEE+EDKET+ T ++L D T+EFG TDGP P S GTWE D + Sbjct: 50 QLEELEDKETATTEILLKSDNTVEFGETDGPRPISCTGTWEHDEDSFKL 98
BLAST of mRNA_P-wetherbeei_contig12881.1.1 vs. uniprot
Match: H6WBB0_VAULI (Uncharacterized protein n=1 Tax=Vaucheria litorea TaxID=109269 RepID=H6WBB0_VAULI) HSP 1 Score: 50.4 bits (119), Expect = 2.150e-6 Identity = 21/42 (50.00%), Postives = 32/42 (76.19%), Query Frame = 1 Query: 4 LEEMEDKETSATSVVLLDDGTLEFGATDGPLPKSSKGTWEAQ 129 LEE+EDK++ TS+VL +DG++ GAT GP+P S++G W + Sbjct: 20 LEELEDKDSCETSIVLNEDGSVSLGATSGPIPMSARGEWSME 61
BLAST of mRNA_P-wetherbeei_contig12881.1.1 vs. uniprot
Match: A0A7S1XJP5_9RHOD (Hypothetical protein n=1 Tax=Erythrolobus australicus TaxID=1077150 RepID=A0A7S1XJP5_9RHOD) HSP 1 Score: 49.7 bits (117), Expect = 7.770e-6 Identity = 23/49 (46.94%), Postives = 32/49 (65.31%), Query Frame = 1 Query: 1 QLEEMEDKETSATSVVLLDDGTLEFGATDGPLPKSSKGTWEAQGDKIMM 147 QL+E+EDKET T++VL GT+ G TDGP+P +G+W G M+ Sbjct: 80 QLDELEDKETMCTALVLNAGGTVTCGKTDGPVPSKVEGSWALTGSDFML 128 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig12881.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig12881.1.1 >prot_P-wetherbeei_contig12881.1.1 ID=prot_P-wetherbeei_contig12881.1.1|Name=mRNA_P-wetherbeei_contig12881.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=45bp MEDKETSATSVVLLDDGTLEFGATDGPLPKSSKGTWEAQGDKIMMback to top mRNA from alignment at P-wetherbeei_contig12881:82..228- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig12881.1.1 ID=mRNA_P-wetherbeei_contig12881.1.1|Name=mRNA_P-wetherbeei_contig12881.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=147bp|location=Sequence derived from alignment at P-wetherbeei_contig12881:82..228- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig12881:82..228- >mRNA_P-wetherbeei_contig12881.1.1 ID=mRNA_P-wetherbeei_contig12881.1.1|Name=mRNA_P-wetherbeei_contig12881.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=135bp|location=Sequence derived from alignment at P-wetherbeei_contig12881:82..228- (Phaeothamnion wetherbeei SAG_119_79)back to top |