prot_P-wetherbeei_contig12881.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig12881.1.1 vs. uniprot
Match: A0A835Z9V2_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z9V2_9STRA) HSP 1 Score: 58.9 bits (141), Expect = 2.210e-9 Identity = 26/36 (72.22%), Postives = 32/36 (88.89%), Query Frame = 0 Query: 1 MEDKETSATSVVLLDDGTLEFGATDGPLPKSSKGTW 36 +EDKET+ATSVVL DG++ FGATDGPLPKS+ G+W Sbjct: 74 LEDKETAATSVVLNGDGSVSFGATDGPLPKSTTGSW 109
BLAST of mRNA_P-wetherbeei_contig12881.1.1 vs. uniprot
Match: A0A6U0KI98_9STRA (Hypothetical protein n=1 Tax=Minutocellus polymorphus TaxID=265543 RepID=A0A6U0KI98_9STRA) HSP 1 Score: 54.3 bits (129), Expect = 1.020e-7 Identity = 24/45 (53.33%), Postives = 30/45 (66.67%), Query Frame = 0 Query: 1 MEDKETSATSVVLLDDGTLEFGATDGPLPKSSKGTWEAQGDKIMM 45 +ED++ +T V+L DDGT+ GATDGP P S GTWE GD M Sbjct: 54 LEDRDDCSTEVLLKDDGTVTTGATDGPPPSESSGTWEFAGDTFKM 98 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig12881.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig12881.1.1 ID=prot_P-wetherbeei_contig12881.1.1|Name=mRNA_P-wetherbeei_contig12881.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=45bpback to top |