prot_P-canaliculata_contig10169.260.1 (polypeptide) Pelvetia canaliculata dioecious
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_P-canaliculata_contig10169.260.1 vs. uniprot
Match: D8LSH3_ECTSI (Hypothetical leucine rich repeat protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LSH3_ECTSI) HSP 1 Score: 107 bits (266), Expect = 1.390e-22 Identity = 46/64 (71.88%), Postives = 55/64 (85.94%), Query Frame = 0 Query: 8 DRAALAVLFRSCHGPRWLRRAGWSAGSDERTGVAWTSDRSRLIKLELGTNRVEGYMPKELGALS 71 DRAALA+LFRSCHG RWLRRAGW SD R GVAWT++ +R++KLELG NR+EGY+PKELG +S Sbjct: 1023 DRAALAILFRSCHGLRWLRRAGWDGDSDGRHGVAWTAENARVLKLELGNNRLEGYIPKELGVMS 1086
BLAST of mRNA_P-canaliculata_contig10169.260.1 vs. uniprot
Match: A0A6H5L8P8_9PHAE (Protein kinase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L8P8_9PHAE) HSP 1 Score: 105 bits (261), Expect = 6.720e-22 Identity = 44/64 (68.75%), Postives = 55/64 (85.94%), Query Frame = 0 Query: 8 DRAALAVLFRSCHGPRWLRRAGWSAGSDERTGVAWTSDRSRLIKLELGTNRVEGYMPKELGALS 71 DRAALA+LF+SCHG RWLRRAGW SD R GVAWT++ +R++KLELG NR+EGY+P+ELG +S Sbjct: 1553 DRAALAILFQSCHGLRWLRRAGWDGDSDRRHGVAWTTENARVLKLELGNNRLEGYIPRELGVMS 1616
BLAST of mRNA_P-canaliculata_contig10169.260.1 vs. uniprot
Match: A0A6H5KQQ0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KQQ0_9PHAE) HSP 1 Score: 57.4 bits (137), Expect = 4.420e-7 Identity = 29/66 (43.94%), Postives = 42/66 (63.64%), Query Frame = 0 Query: 8 DRAALAVLFRSCHGPRWLRRAGWSAGSDERT--GVAWTSDRSRLIKLELGTNRVEGYMPKELGALS 71 DR AL LF S G W RR W+ +D T GV +D+ R++ ++LG+N ++G +PKELGAL+ Sbjct: 5 DRDALVALFCSTGGAGWTRRDNWNTDADRATWFGVK-VNDQGRVVDVDLGSNNLQGPIPKELGALA 69 The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig10169.260.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-canaliculata_contig10169.260.1 ID=prot_P-canaliculata_contig10169.260.1|Name=mRNA_P-canaliculata_contig10169.260.1|organism=Pelvetia canaliculata dioecious|type=polypeptide|length=257bpback to top |