mRNA_P-canaliculata_contig10169.260.1 (mRNA) Pelvetia canaliculata dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_P-canaliculata_contig10169.260.1 vs. uniprot
Match: D8LSH3_ECTSI (Hypothetical leucine rich repeat protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LSH3_ECTSI) HSP 1 Score: 107 bits (266), Expect = 1.390e-22 Identity = 46/64 (71.88%), Postives = 55/64 (85.94%), Query Frame = 1 Query: 22 DRAALAVLFRSCHGPRWLRRAGWSAGSDERTGVAWTSDRSRLIKLELGTNRVEGYMPKELGALS 213 DRAALA+LFRSCHG RWLRRAGW SD R GVAWT++ +R++KLELG NR+EGY+PKELG +S Sbjct: 1023 DRAALAILFRSCHGLRWLRRAGWDGDSDGRHGVAWTAENARVLKLELGNNRLEGYIPKELGVMS 1086
BLAST of mRNA_P-canaliculata_contig10169.260.1 vs. uniprot
Match: A0A6H5L8P8_9PHAE (Protein kinase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L8P8_9PHAE) HSP 1 Score: 105 bits (261), Expect = 6.720e-22 Identity = 44/64 (68.75%), Postives = 55/64 (85.94%), Query Frame = 1 Query: 22 DRAALAVLFRSCHGPRWLRRAGWSAGSDERTGVAWTSDRSRLIKLELGTNRVEGYMPKELGALS 213 DRAALA+LF+SCHG RWLRRAGW SD R GVAWT++ +R++KLELG NR+EGY+P+ELG +S Sbjct: 1553 DRAALAILFQSCHGLRWLRRAGWDGDSDRRHGVAWTTENARVLKLELGNNRLEGYIPRELGVMS 1616
BLAST of mRNA_P-canaliculata_contig10169.260.1 vs. uniprot
Match: A0A6H5KQQ0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KQQ0_9PHAE) HSP 1 Score: 57.4 bits (137), Expect = 4.420e-7 Identity = 29/66 (43.94%), Postives = 42/66 (63.64%), Query Frame = 1 Query: 22 DRAALAVLFRSCHGPRWLRRAGWSAGSDERT--GVAWTSDRSRLIKLELGTNRVEGYMPKELGALS 213 DR AL LF S G W RR W+ +D T GV +D+ R++ ++LG+N ++G +PKELGAL+ Sbjct: 5 DRDALVALFCSTGGAGWTRRDNWNTDADRATWFGVK-VNDQGRVVDVDLGSNNLQGPIPKELGALA 69 The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig10169.260.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-canaliculata_contig10169.260.1 >prot_P-canaliculata_contig10169.260.1 ID=prot_P-canaliculata_contig10169.260.1|Name=mRNA_P-canaliculata_contig10169.260.1|organism=Pelvetia canaliculata dioecious|type=polypeptide|length=257bp MVPAHVDDRAALAVLFRSCHGPRWLRRAGWSAGSDERTGVAWTSDRSRLIback to top mRNA from alignment at P-canaliculata_contig10169:2556..10232- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-canaliculata_contig10169.260.1 ID=mRNA_P-canaliculata_contig10169.260.1|Name=mRNA_P-canaliculata_contig10169.260.1|organism=Pelvetia canaliculata dioecious|type=mRNA|length=7677bp|location=Sequence derived from alignment at P-canaliculata_contig10169:2556..10232- (Pelvetia canaliculata dioecious)back to top Coding sequence (CDS) from alignment at P-canaliculata_contig10169:2556..10232- >mRNA_P-canaliculata_contig10169.260.1 ID=mRNA_P-canaliculata_contig10169.260.1|Name=mRNA_P-canaliculata_contig10169.260.1|organism=Pelvetia canaliculata dioecious|type=CDS|length=1542bp|location=Sequence derived from alignment at P-canaliculata_contig10169:2556..10232- (Pelvetia canaliculata dioecious)back to top |