mRNA_M-pyrifera_M_contig99986.22994.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig99986.22994.1 vs. uniprot
Match: A0A5A8DFN4_CAFRO (Uncharacterized protein n=2 Tax=Cafeteria roenbergensis TaxID=33653 RepID=A0A5A8DFN4_CAFRO) HSP 1 Score: 85.1 bits (209), Expect = 8.370e-20 Identity = 33/64 (51.56%), Postives = 49/64 (76.56%), Query Frame = 1 Query: 16 ELKNSISCVECLNALAYCLGPRHQFASYWREGEFDSCRQRFGELKFCFKLKAANKTELREMAKE 207 EL++SI C +C+NALA+C PRHQF YWR+G FD+C ++F EL+FC+ LK A+ + +EM ++ Sbjct: 19 ELRDSIKCTDCMNALAFCFSPRHQFDLYWRQGTFDTCAKQFEELRFCYSLKTADSAKAKEMLRK 82
BLAST of mRNA_M-pyrifera_M_contig99986.22994.1 vs. uniprot
Match: A0A176WC03_MARPO (Uncharacterized protein n=2 Tax=Marchantia polymorpha TaxID=3197 RepID=A0A176WC03_MARPO) HSP 1 Score: 58.2 bits (139), Expect = 2.050e-9 Identity = 26/62 (41.94%), Postives = 38/62 (61.29%), Query Frame = 1 Query: 22 KNSISCVECLNALAYCLGPRHQFASYWREGEFDSCRQRFGELKFCFKLKAANKTELREMAKE 207 K S+SC C++AL +C P Q Y+REGE DSC++++ EL C LK +E+ + KE Sbjct: 8 KKSLSCSPCIDALWFCYSPVFQVKQYYREGELDSCKEKWTELFSCISLKTRPASEVEAILKE 69 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig99986.22994.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig99986.22994.1 >prot_M-pyrifera_M_contig99986.22994.1 ID=prot_M-pyrifera_M_contig99986.22994.1|Name=mRNA_M-pyrifera_M_contig99986.22994.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=69bp MDPDSELKNSISCVECLNALAYCLGPRHQFASYWREGEFDSCRQRFGELKback to top mRNA from alignment at M-pyrifera_M_contig99986:303..602+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig99986.22994.1 ID=mRNA_M-pyrifera_M_contig99986.22994.1|Name=mRNA_M-pyrifera_M_contig99986.22994.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=300bp|location=Sequence derived from alignment at M-pyrifera_M_contig99986:303..602+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig99986:303..602+ >mRNA_M-pyrifera_M_contig99986.22994.1 ID=mRNA_M-pyrifera_M_contig99986.22994.1|Name=mRNA_M-pyrifera_M_contig99986.22994.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=414bp|location=Sequence derived from alignment at M-pyrifera_M_contig99986:303..602+ (Macrocystis pyrifera P11B4 male)back to top |