mRNA_M-pyrifera_M_contig99978.22989.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig99978.22989.1 vs. uniprot
Match: A0A812KHN9_9DINO (Gpr137b protein n=1 Tax=Symbiodinium sp. KB8 TaxID=230985 RepID=A0A812KHN9_9DINO) HSP 1 Score: 55.1 bits (131), Expect = 2.060e-6 Identity = 33/105 (31.43%), Postives = 56/105 (53.33%), Query Frame = 1 Query: 1 SALIFLALAVTFMFQAWYLSRMSTEEARRLGIFQPRSLVVTCSCLVVIFVTRVAWDIAAAAGRSFASVALDAHSPSKVARLLVAYIWWEDVPVWILIFVIAGAKV 315 S +IF LA F + +++ + ++ R+ + +P S+ L V+FV+R +D+ AAG S A S VA + AY+WWE +P+ +L+ IA +V Sbjct: 148 SGIIFGFLASAFAWVTYHVLHLEPQQYSRMFMMRPTSVAAVVVVLFVVFVSRAVFDVVTAAGAVTISTGGQA-STEDVAIFVSAYLWWEVLPIVLLLATIAAGRV 251 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig99978.22989.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig99978.22989.1 >prot_M-pyrifera_M_contig99978.22989.1 ID=prot_M-pyrifera_M_contig99978.22989.1|Name=mRNA_M-pyrifera_M_contig99978.22989.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=115bp SALIFLALAVTFMFQAWYLSRMSTEEARRLGIFQPRSLVVTCSCLVVIFVback to top mRNA from alignment at M-pyrifera_M_contig99978:125..469- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig99978.22989.1 ID=mRNA_M-pyrifera_M_contig99978.22989.1|Name=mRNA_M-pyrifera_M_contig99978.22989.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=345bp|location=Sequence derived from alignment at M-pyrifera_M_contig99978:125..469- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig99978:125..469- >mRNA_M-pyrifera_M_contig99978.22989.1 ID=mRNA_M-pyrifera_M_contig99978.22989.1|Name=mRNA_M-pyrifera_M_contig99978.22989.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=690bp|location=Sequence derived from alignment at M-pyrifera_M_contig99978:125..469- (Macrocystis pyrifera P11B4 male)back to top |