mRNA_M-pyrifera_M_contig97543.22471.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig97543.22471.1 vs. uniprot
Match: A0A6A4ZZJ8_9STRA (SAM_MT_RSMB_NOP domain-containing protein n=6 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A6A4ZZJ8_9STRA) HSP 1 Score: 54.7 bits (130), Expect = 6.670e-7 Identity = 34/75 (45.33%), Postives = 42/75 (56.00%), Query Frame = 1 Query: 1 LHTHPLITRGSLQLQELASALPALAIQHHLLHNPFPLSPWCAIDTCAAPGNKTVQLCEAVHTLQPNPKDSKIQGV 225 LH HPLI +G L +Q+LAS LP + + F AIDTCAAPGNKT QL A PK+ ++Q V Sbjct: 195 LHGHPLIKKGCLFVQDLASCLPVACLAPQASAHDF------AIDTCAAPGNKTTQL--AAKLALGKPKNRRVQVV 261
BLAST of mRNA_M-pyrifera_M_contig97543.22471.1 vs. uniprot
Match: A0A024U9Q2_9STRA (SAM_MT_RSMB_NOP domain-containing protein (Fragment) n=2 Tax=Aphanomyces invadans TaxID=157072 RepID=A0A024U9Q2_9STRA) HSP 1 Score: 54.3 bits (129), Expect = 9.140e-7 Identity = 33/75 (44.00%), Postives = 41/75 (54.67%), Query Frame = 1 Query: 1 LHTHPLITRGSLQLQELASALPALAIQHHLLHNPFPLSPWCAIDTCAAPGNKTVQLCEAVHTLQPNPKDSKIQGV 225 LH HPLI +G L +Q+LAS LP + + + AIDTCAAPGNKT QL A PK ++Q V Sbjct: 195 LHGHPLIKKGCLFVQDLASCLPVACVAAQAMDHDV------AIDTCAAPGNKTTQL--AARLALGKPKSRRVQVV 261 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig97543.22471.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig97543.22471.1 >prot_M-pyrifera_M_contig97543.22471.1 ID=prot_M-pyrifera_M_contig97543.22471.1|Name=mRNA_M-pyrifera_M_contig97543.22471.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=75bp LHTHPLITRGSLQLQELASALPALAIQHHLLHNPFPLSPWCAIDTCAAPGback to top mRNA from alignment at M-pyrifera_M_contig97543:52..276- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig97543.22471.1 ID=mRNA_M-pyrifera_M_contig97543.22471.1|Name=mRNA_M-pyrifera_M_contig97543.22471.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=225bp|location=Sequence derived from alignment at M-pyrifera_M_contig97543:52..276- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig97543:52..276- >mRNA_M-pyrifera_M_contig97543.22471.1 ID=mRNA_M-pyrifera_M_contig97543.22471.1|Name=mRNA_M-pyrifera_M_contig97543.22471.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=450bp|location=Sequence derived from alignment at M-pyrifera_M_contig97543:52..276- (Macrocystis pyrifera P11B4 male)back to top |