prot_M-pyrifera_M_contig90263.20924.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig90263.20924.1 vs. uniprot
Match: A0A0L0HV40_SPIPD (Uncharacterized protein n=2 Tax=Spizellomyces TaxID=4815 RepID=A0A0L0HV40_SPIPD) HSP 1 Score: 57.0 bits (136), Expect = 3.260e-7 Identity = 30/88 (34.09%), Postives = 50/88 (56.82%), Query Frame = 0 Query: 5 TAPLLLMPVVGQILACLVMSWASAWMLLTAFFTRQGLSLKWQARLIYMRFGEYMAFGVPVTIIQHIPIVSSLFVFVDVTGAALWAVDM 92 TAPL L+P+ G IL L+ + +AW L +F +G + + Y +FG +++ +PI+ LF+F ++ G+ALWA+DM Sbjct: 143 TAPLHLLPIFGTILFLLLNGYLAAWALHLHWFDLRGFGFTAGKKFVRSHRQAYTSFGSVAVLLEMVPIIGMLFMFTNIVGSALWAIDM 230
BLAST of mRNA_M-pyrifera_M_contig90263.20924.1 vs. uniprot
Match: A0A5N5DRP8_9PEZI (Outer spore wall protein LDS1 n=4 Tax=Botryosphaeriaceae TaxID=45131 RepID=A0A5N5DRP8_9PEZI) HSP 1 Score: 50.4 bits (119), Expect = 8.510e-5 Identity = 29/86 (33.72%), Postives = 45/86 (52.33%), Query Frame = 0 Query: 7 PLLLMPVVGQILACLVMSWASAWMLLTAFFTRQGLSLKWQARLIYMRFGEYMAFGVPVTIIQHIPIVSSLFVFVDVTGAALWAVDM 92 PL +PVVG ++ ++ + +F +G+ + + I R Y +FGVPV ++Q IP+ F F + GAALWA DM Sbjct: 173 PLNFIPVVGTVMFIILQGRKAGPAAHARYFQLKGMKSRQKEDFIEQRKAAYTSFGVPVVLLQLIPVAGLFFSFTNAVGAALWAADM 258 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig90263.20924.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig90263.20924.1 ID=prot_M-pyrifera_M_contig90263.20924.1|Name=mRNA_M-pyrifera_M_contig90263.20924.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=121bpback to top |