mRNA_M-pyrifera_M_contig90263.20924.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig90263.20924.1 vs. uniprot
Match: A0A0L0HV40_SPIPD (Uncharacterized protein n=2 Tax=Spizellomyces TaxID=4815 RepID=A0A0L0HV40_SPIPD) HSP 1 Score: 57.0 bits (136), Expect = 3.890e-7 Identity = 30/88 (34.09%), Postives = 50/88 (56.82%), Query Frame = 1 Query: 31 TAPLLLMPVVGQILACLVMSWASAWMLLTAFFTRQGLSLKWQARLIYMRFGEYMAFGVPVTIIQHIPIVSSLFVFVDVTGAALWAVDM 294 TAPL L+P+ G IL L+ + +AW L +F +G + + Y +FG +++ +PI+ LF+F ++ G+ALWA+DM Sbjct: 143 TAPLHLLPIFGTILFLLLNGYLAAWALHLHWFDLRGFGFTAGKKFVRSHRQAYTSFGSVAVLLEMVPIIGMLFMFTNIVGSALWAIDM 230 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig90263.20924.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig90263.20924.1 >prot_M-pyrifera_M_contig90263.20924.1 ID=prot_M-pyrifera_M_contig90263.20924.1|Name=mRNA_M-pyrifera_M_contig90263.20924.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=121bp MELLTAPLLLMPVVGQILACLVMSWASAWMLLTAFFTRQGLSLKWQARLIback to top mRNA from alignment at M-pyrifera_M_contig90263:80..460+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig90263.20924.1 ID=mRNA_M-pyrifera_M_contig90263.20924.1|Name=mRNA_M-pyrifera_M_contig90263.20924.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=381bp|location=Sequence derived from alignment at M-pyrifera_M_contig90263:80..460+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig90263:80..460+ >mRNA_M-pyrifera_M_contig90263.20924.1 ID=mRNA_M-pyrifera_M_contig90263.20924.1|Name=mRNA_M-pyrifera_M_contig90263.20924.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=726bp|location=Sequence derived from alignment at M-pyrifera_M_contig90263:80..460+ (Macrocystis pyrifera P11B4 male)back to top |