mRNA_M-pyrifera_M_contig83236.19439.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig83236.19439.1 vs. uniprot
Match: A0A1M5XW04_9BRAD (Transcriptional regulator, MarR family n=4 Tax=Bradyrhizobium TaxID=374 RepID=A0A1M5XW04_9BRAD) HSP 1 Score: 51.6 bits (122), Expect = 6.710e-6 Identity = 33/71 (46.48%), Postives = 40/71 (56.34%), Query Frame = 1 Query: 76 LTFSQVKHLTLIDEGCRGDGCWSLQRLADELTISLPALSKNVSKLAAMGLVEVRQDPFDGRKRRVSLTDLG 288 L +Q L I E RG +LQ LA+ L I + AL+ V L GLVE+RQDP DGR +R LT LG Sbjct: 37 LKATQAGLLAQIGELARGQEGPTLQDLAERLAIGISALTHAVRPLVRDGLVELRQDPQDGRTKRGILTRLG 107 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig83236.19439.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig83236.19439.1 >prot_M-pyrifera_M_contig83236.19439.1 ID=prot_M-pyrifera_M_contig83236.19439.1|Name=mRNA_M-pyrifera_M_contig83236.19439.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=96bp NLSRLKTEITKILESDCIVPELERPLTFSQVKHLTLIDEGCRGDGCWSLQback to top mRNA from alignment at M-pyrifera_M_contig83236:6..293- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig83236.19439.1 ID=mRNA_M-pyrifera_M_contig83236.19439.1|Name=mRNA_M-pyrifera_M_contig83236.19439.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=288bp|location=Sequence derived from alignment at M-pyrifera_M_contig83236:6..293- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig83236:6..293- >mRNA_M-pyrifera_M_contig83236.19439.1 ID=mRNA_M-pyrifera_M_contig83236.19439.1|Name=mRNA_M-pyrifera_M_contig83236.19439.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=576bp|location=Sequence derived from alignment at M-pyrifera_M_contig83236:6..293- (Macrocystis pyrifera P11B4 male)back to top |