prot_M-pyrifera_M_contig83236.19439.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig83236.19439.1 vs. uniprot
Match: A0A1M5XW04_9BRAD (Transcriptional regulator, MarR family n=4 Tax=Bradyrhizobium TaxID=374 RepID=A0A1M5XW04_9BRAD) HSP 1 Score: 51.6 bits (122), Expect = 6.710e-6 Identity = 33/71 (46.48%), Postives = 40/71 (56.34%), Query Frame = 0 Query: 26 LTFSQVKHLTLIDEGCRGDGCWSLQRLADELTISLPALSKNVSKLAAMGLVEVRQDPFDGRKRRVSLTDLG 96 L +Q L I E RG +LQ LA+ L I + AL+ V L GLVE+RQDP DGR +R LT LG Sbjct: 37 LKATQAGLLAQIGELARGQEGPTLQDLAERLAIGISALTHAVRPLVRDGLVELRQDPQDGRTKRGILTRLG 107 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig83236.19439.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig83236.19439.1 ID=prot_M-pyrifera_M_contig83236.19439.1|Name=mRNA_M-pyrifera_M_contig83236.19439.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=96bpback to top |