prot_M-pyrifera_M_contig78610.18471.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig78610.18471.1 vs. uniprot
Match: A0A1W4WQV4_AGRPL (centrosomal protein of 164 kDa isoform X1 n=4 Tax=Agrilus planipennis TaxID=224129 RepID=A0A1W4WQV4_AGRPL) HSP 1 Score: 50.8 bits (120), Expect = 7.150e-6 Identity = 18/31 (58.06%), Postives = 25/31 (80.65%), Query Frame = 0 Query: 23 LPPGWQKIWDEGNECFYYFNEETEESQWEAP 53 LPPGW+ +DE +C+YYFN+ET ++QWE P Sbjct: 54 LPPGWKPFYDETRKCYYYFNKETNKTQWEHP 84
BLAST of mRNA_M-pyrifera_M_contig78610.18471.1 vs. uniprot
Match: A0A0M9VVN6_9HYPO (WW domain-containing protein n=1 Tax=Escovopsis weberi TaxID=150374 RepID=A0A0M9VVN6_9HYPO) HSP 1 Score: 48.5 bits (114), Expect = 4.570e-5 Identity = 21/38 (55.26%), Postives = 26/38 (68.42%), Query Frame = 0 Query: 16 PAGDDEDLPPGWQKIWDEGNECFYYFNEETEESQWEAP 53 P GD LP GW IWD N+ +YY NE+T ++QWEAP Sbjct: 51 PPGDRPPLPQGWIPIWDHVNQRWYYANEQTGQTQWEAP 88 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig78610.18471.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig78610.18471.1 ID=prot_M-pyrifera_M_contig78610.18471.1|Name=mRNA_M-pyrifera_M_contig78610.18471.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=56bpback to top |