mRNA_M-pyrifera_M_contig78610.18471.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig78610.18471.1 vs. uniprot
Match: A0A1W4WQV4_AGRPL (centrosomal protein of 164 kDa isoform X1 n=4 Tax=Agrilus planipennis TaxID=224129 RepID=A0A1W4WQV4_AGRPL) HSP 1 Score: 50.8 bits (120), Expect = 7.150e-6 Identity = 18/31 (58.06%), Postives = 25/31 (80.65%), Query Frame = 1 Query: 67 LPPGWQKIWDEGNECFYYFNEETEESQWEAP 159 LPPGW+ +DE +C+YYFN+ET ++QWE P Sbjct: 54 LPPGWKPFYDETRKCYYYFNKETNKTQWEHP 84
BLAST of mRNA_M-pyrifera_M_contig78610.18471.1 vs. uniprot
Match: A0A0M9VVN6_9HYPO (WW domain-containing protein n=1 Tax=Escovopsis weberi TaxID=150374 RepID=A0A0M9VVN6_9HYPO) HSP 1 Score: 48.5 bits (114), Expect = 4.570e-5 Identity = 21/38 (55.26%), Postives = 26/38 (68.42%), Query Frame = 1 Query: 46 PAGDDEDLPPGWQKIWDEGNECFYYFNEETEESQWEAP 159 P GD LP GW IWD N+ +YY NE+T ++QWEAP Sbjct: 51 PPGDRPPLPQGWIPIWDHVNQRWYYANEQTGQTQWEAP 88 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig78610.18471.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig78610.18471.1 >prot_M-pyrifera_M_contig78610.18471.1 ID=prot_M-pyrifera_M_contig78610.18471.1|Name=mRNA_M-pyrifera_M_contig78610.18471.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=56bp AAAEEEEAAADGGETPAGDDEDLPPGWQKIWDEGNECFYYFNEETEESQWback to top mRNA from alignment at M-pyrifera_M_contig78610:88..255- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig78610.18471.1 ID=mRNA_M-pyrifera_M_contig78610.18471.1|Name=mRNA_M-pyrifera_M_contig78610.18471.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=168bp|location=Sequence derived from alignment at M-pyrifera_M_contig78610:88..255- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig78610:88..255- >mRNA_M-pyrifera_M_contig78610.18471.1 ID=mRNA_M-pyrifera_M_contig78610.18471.1|Name=mRNA_M-pyrifera_M_contig78610.18471.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=336bp|location=Sequence derived from alignment at M-pyrifera_M_contig78610:88..255- (Macrocystis pyrifera P11B4 male)back to top |