mRNA_M-pyrifera_M_contig7648.18027.1 (mRNA) Macrocystis pyrifera P11B4 male
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig7648.18027.1 vs. uniprot
Match: A0A6H5JPW9_9PHAE (Bms1-type G domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5JPW9_9PHAE) HSP 1 Score: 94.4 bits (233), Expect = 1.190e-20 Identity = 47/51 (92.16%), Postives = 50/51 (98.04%), Query Frame = 2 Query: 2 MVSAAFNQFKQRVTFLTPGRDLASVLEFAKVADLLLVVLPVEQGADSAVDE 154 MVSA F+QFKQRVTFLTPGRDLA+VLEFAKVADLLLVVLPV+QGADSAVDE Sbjct: 126 MVSAVFHQFKQRVTFLTPGRDLAAVLEFAKVADLLLVVLPVQQGADSAVDE 176
BLAST of mRNA_M-pyrifera_M_contig7648.18027.1 vs. uniprot
Match: A0A835YTY8_9STRA (Bms1-type G domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YTY8_9STRA) HSP 1 Score: 63.2 bits (152), Expect = 1.090e-9 Identity = 29/51 (56.86%), Postives = 39/51 (76.47%), Query Frame = 2 Query: 2 MVSAAFNQFKQRVTFLTPGRDLASVLEFAKVADLLLVVLPVEQGADSAVDE 154 M + F+Q+KQRVTF+ P R VLE AKVADL+L+VLPV+QG + A+D+ Sbjct: 131 MSTVLFSQYKQRVTFVHPKRSAMDVLELAKVADLVLLVLPVQQGTEHAIDQ 181
BLAST of mRNA_M-pyrifera_M_contig7648.18027.1 vs. uniprot
Match: L8H0X3_ACACA (Bms1-type G domain-containing protein n=1 Tax=Acanthamoeba castellanii str. Neff TaxID=1257118 RepID=L8H0X3_ACACA) HSP 1 Score: 50.1 bits (118), Expect = 4.480e-5 Identity = 22/46 (47.83%), Postives = 33/46 (71.74%), Query Frame = 2 Query: 5 VSAAFNQFKQRVTFLTPGRDLASVLEFAKVADLLLVVLPVEQGADS 142 ++A F FKQR+T RD+ +VL+ AKVAD+LL+V+P + G D+ Sbjct: 124 ITANFPAFKQRMTLFEAPRDIEAVLDIAKVADILLLVIPADGGVDA 169 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig7648.18027.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig7648.18027.1 >prot_M-pyrifera_M_contig7648.18027.1 ID=prot_M-pyrifera_M_contig7648.18027.1|Name=mRNA_M-pyrifera_M_contig7648.18027.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=56bp MVSAAFNQFKQRVTFLTPGRDLASVLEFAKVADLLLVVLPVEQGADSAVDback to top mRNA from alignment at M-pyrifera_M_contig7648:9184..9443+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig7648.18027.1 ID=mRNA_M-pyrifera_M_contig7648.18027.1|Name=mRNA_M-pyrifera_M_contig7648.18027.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=260bp|location=Sequence derived from alignment at M-pyrifera_M_contig7648:9184..9443+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig7648:9184..9443+ >mRNA_M-pyrifera_M_contig7648.18027.1 ID=mRNA_M-pyrifera_M_contig7648.18027.1|Name=mRNA_M-pyrifera_M_contig7648.18027.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=336bp|location=Sequence derived from alignment at M-pyrifera_M_contig7648:9184..9443+ (Macrocystis pyrifera P11B4 male)back to top |