mRNA_M-pyrifera_M_contig7648.18027.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig7648.18027.1 vs. uniprot
Match: A0A6H5JPW9_9PHAE (Bms1-type G domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5JPW9_9PHAE) HSP 1 Score: 94.4 bits (233), Expect = 1.190e-20 Identity = 47/51 (92.16%), Postives = 50/51 (98.04%), Query Frame = 2 Query: 2 MVSAAFNQFKQRVTFLTPGRDLASVLEFAKVADLLLVVLPVEQGADSAVDE 154 MVSA F+QFKQRVTFLTPGRDLA+VLEFAKVADLLLVVLPV+QGADSAVDE Sbjct: 126 MVSAVFHQFKQRVTFLTPGRDLAAVLEFAKVADLLLVVLPVQQGADSAVDE 176
BLAST of mRNA_M-pyrifera_M_contig7648.18027.1 vs. uniprot
Match: A0A835YTY8_9STRA (Bms1-type G domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YTY8_9STRA) HSP 1 Score: 63.2 bits (152), Expect = 1.090e-9 Identity = 29/51 (56.86%), Postives = 39/51 (76.47%), Query Frame = 2 Query: 2 MVSAAFNQFKQRVTFLTPGRDLASVLEFAKVADLLLVVLPVEQGADSAVDE 154 M + F+Q+KQRVTF+ P R VLE AKVADL+L+VLPV+QG + A+D+ Sbjct: 131 MSTVLFSQYKQRVTFVHPKRSAMDVLELAKVADLVLLVLPVQQGTEHAIDQ 181
BLAST of mRNA_M-pyrifera_M_contig7648.18027.1 vs. uniprot
Match: L8H0X3_ACACA (Bms1-type G domain-containing protein n=1 Tax=Acanthamoeba castellanii str. Neff TaxID=1257118 RepID=L8H0X3_ACACA) HSP 1 Score: 50.1 bits (118), Expect = 4.480e-5 Identity = 22/46 (47.83%), Postives = 33/46 (71.74%), Query Frame = 2 Query: 5 VSAAFNQFKQRVTFLTPGRDLASVLEFAKVADLLLVVLPVEQGADS 142 ++A F FKQR+T RD+ +VL+ AKVAD+LL+V+P + G D+ Sbjct: 124 ITANFPAFKQRMTLFEAPRDIEAVLDIAKVADILLLVIPADGGVDA 169 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig7648.18027.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig7648.18027.1 >prot_M-pyrifera_M_contig7648.18027.1 ID=prot_M-pyrifera_M_contig7648.18027.1|Name=mRNA_M-pyrifera_M_contig7648.18027.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=56bp MVSAAFNQFKQRVTFLTPGRDLASVLEFAKVADLLLVVLPVEQGADSAVDback to top mRNA from alignment at M-pyrifera_M_contig7648:9184..9443+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig7648.18027.1 ID=mRNA_M-pyrifera_M_contig7648.18027.1|Name=mRNA_M-pyrifera_M_contig7648.18027.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=260bp|location=Sequence derived from alignment at M-pyrifera_M_contig7648:9184..9443+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig7648:9184..9443+ >mRNA_M-pyrifera_M_contig7648.18027.1 ID=mRNA_M-pyrifera_M_contig7648.18027.1|Name=mRNA_M-pyrifera_M_contig7648.18027.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=336bp|location=Sequence derived from alignment at M-pyrifera_M_contig7648:9184..9443+ (Macrocystis pyrifera P11B4 male)back to top |