prot_M-pyrifera_M_contig7648.18027.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig7648.18027.1 vs. uniprot
Match: A0A6H5JPW9_9PHAE (Bms1-type G domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5JPW9_9PHAE) HSP 1 Score: 93.6 bits (231), Expect = 6.300e-21 Identity = 47/51 (92.16%), Postives = 50/51 (98.04%), Query Frame = 0 Query: 1 MVSAAFNQFKQRVTFLTPGRDLASVLEFAKVADLLLVVLPVEQGADSAVDE 51 MVSA F+QFKQRVTFLTPGRDLA+VLEFAKVADLLLVVLPV+QGADSAVDE Sbjct: 126 MVSAVFHQFKQRVTFLTPGRDLAAVLEFAKVADLLLVVLPVQQGADSAVDE 176
BLAST of mRNA_M-pyrifera_M_contig7648.18027.1 vs. uniprot
Match: A0A835YTY8_9STRA (Bms1-type G domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YTY8_9STRA) HSP 1 Score: 62.4 bits (150), Expect = 5.940e-10 Identity = 29/51 (56.86%), Postives = 39/51 (76.47%), Query Frame = 0 Query: 1 MVSAAFNQFKQRVTFLTPGRDLASVLEFAKVADLLLVVLPVEQGADSAVDE 51 M + F+Q+KQRVTF+ P R VLE AKVADL+L+VLPV+QG + A+D+ Sbjct: 131 MSTVLFSQYKQRVTFVHPKRSAMDVLELAKVADLVLLVLPVQQGTEHAIDQ 181
BLAST of mRNA_M-pyrifera_M_contig7648.18027.1 vs. uniprot
Match: L8H0X3_ACACA (Bms1-type G domain-containing protein n=1 Tax=Acanthamoeba castellanii str. Neff TaxID=1257118 RepID=L8H0X3_ACACA) HSP 1 Score: 49.7 bits (117), Expect = 1.830e-5 Identity = 22/46 (47.83%), Postives = 33/46 (71.74%), Query Frame = 0 Query: 2 VSAAFNQFKQRVTFLTPGRDLASVLEFAKVADLLLVVLPVEQGADS 47 ++A F FKQR+T RD+ +VL+ AKVAD+LL+V+P + G D+ Sbjct: 124 ITANFPAFKQRMTLFEAPRDIEAVLDIAKVADILLLVIPADGGVDA 169 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig7648.18027.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig7648.18027.1 ID=prot_M-pyrifera_M_contig7648.18027.1|Name=mRNA_M-pyrifera_M_contig7648.18027.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=56bpback to top |