mRNA_M-pyrifera_M_contig76464.18024.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig76464.18024.1 vs. uniprot
Match: D7FRE9_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FRE9_ECTSI) HSP 1 Score: 58.9 bits (141), Expect = 1.330e-9 Identity = 30/39 (76.92%), Postives = 32/39 (82.05%), Query Frame = 1 Query: 1 AFGGVTAGTLLATYRGHSVPFYAASMGANYAMGSLAFFG 117 A G GT+LATYRGHSVPFYAASMG NYA+ SLAFFG Sbjct: 39 ATSGAVFGTVLATYRGHSVPFYAASMGTNYALASLAFFG 77 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig76464.18024.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig76464.18024.1 >prot_M-pyrifera_M_contig76464.18024.1 ID=prot_M-pyrifera_M_contig76464.18024.1|Name=mRNA_M-pyrifera_M_contig76464.18024.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=39bp AFGGVTAGTLLATYRGHSVPFYAASMGANYAMGSLAFFGback to top mRNA from alignment at M-pyrifera_M_contig76464:155..271+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig76464.18024.1 ID=mRNA_M-pyrifera_M_contig76464.18024.1|Name=mRNA_M-pyrifera_M_contig76464.18024.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=117bp|location=Sequence derived from alignment at M-pyrifera_M_contig76464:155..271+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig76464:155..271+ >mRNA_M-pyrifera_M_contig76464.18024.1 ID=mRNA_M-pyrifera_M_contig76464.18024.1|Name=mRNA_M-pyrifera_M_contig76464.18024.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=234bp|location=Sequence derived from alignment at M-pyrifera_M_contig76464:155..271+ (Macrocystis pyrifera P11B4 male)back to top |