mRNA_M-pyrifera_M_contig76398.18010.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig76398.18010.1 vs. uniprot
Match: D8LHR8_ECTSI (CTLH domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LHR8_ECTSI) HSP 1 Score: 77.4 bits (189), Expect = 2.240e-15 Identity = 33/49 (67.35%), Postives = 41/49 (83.67%), Query Frame = 1 Query: 1 ETRRFVPTVVMRGSYPIRAVGFSPDGGLFAAGSNDRALRVCRTPTEAEL 147 E RF PT+++ GS+P+R+VGFS DGGLFA G NDR LRVC+TP+EAEL Sbjct: 703 EASRFFPTILVSGSHPVRSVGFSADGGLFAVGCNDRTLRVCKTPSEAEL 751 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig76398.18010.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig76398.18010.1 >prot_M-pyrifera_M_contig76398.18010.1 ID=prot_M-pyrifera_M_contig76398.18010.1|Name=mRNA_M-pyrifera_M_contig76398.18010.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=39bp MRGSYPIRAVGFSPDGGLFAAGSNDRALRVCRTPTEAELback to top mRNA from alignment at M-pyrifera_M_contig76398:305..451+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig76398.18010.1 ID=mRNA_M-pyrifera_M_contig76398.18010.1|Name=mRNA_M-pyrifera_M_contig76398.18010.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=147bp|location=Sequence derived from alignment at M-pyrifera_M_contig76398:305..451+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig76398:305..451+ >mRNA_M-pyrifera_M_contig76398.18010.1 ID=mRNA_M-pyrifera_M_contig76398.18010.1|Name=mRNA_M-pyrifera_M_contig76398.18010.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=234bp|location=Sequence derived from alignment at M-pyrifera_M_contig76398:305..451+ (Macrocystis pyrifera P11B4 male)back to top |