prot_M-pyrifera_M_contig96119.22158.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig96119.22158.1 vs. uniprot
Match: A0A0L0FCB8_9EUKA (Uncharacterized protein n=2 Tax=Sphaeroforma arctica JP610 TaxID=667725 RepID=A0A0L0FCB8_9EUKA) HSP 1 Score: 65.5 bits (158), Expect = 1.940e-10 Identity = 37/101 (36.63%), Postives = 57/101 (56.44%), Query Frame = 0 Query: 2 LFSTLAWLGILHDRMHD-------FWRFMEVTIPPHPISFIYSEDDQMTPVKPLDDLVQLKKHQGVNIAHVCRLKSSPHVTHLRHHPQTYTTLAKNVLKAA 95 +F +A LG+++ R FW M+ + +IYS DD++T K LD+L+ +K +GV I + RL+SSPHV HL+ HP+ Y N+L+ A Sbjct: 226 VFGIVAALGVVYARATGAPGRGVVFWDHMQQSNLGCKQYYIYSVDDELTDAKYLDELIAYRKEKGVEITAI-RLESSPHVQHLKSHPEVYNQFVDNILEEA 325
BLAST of mRNA_M-pyrifera_M_contig96119.22158.1 vs. uniprot
Match: A0A0L0FF09_9EUKA (Uncharacterized protein n=2 Tax=Sphaeroforma arctica JP610 TaxID=667725 RepID=A0A0L0FF09_9EUKA) HSP 1 Score: 61.6 bits (148), Expect = 4.730e-9 Identity = 36/96 (37.50%), Postives = 54/96 (56.25%), Query Frame = 0 Query: 1 KLFSTLAWLGILHDRMHDFWRFMEVTIPPHPISFIYSEDDQMTPVKPLDDLVQLKKHQGVNIAHVCRLKSSPHVTHLRHHPQTYTTLAKNVLKAAQ 96 KL + LA R FW M+ + +IYS DD +T VK LD+L+ ++ +GV I + RL+SSPHV HL++HP+ Y +L+ A+ Sbjct: 239 KLIAVLAETTDSIMRGTLFWEHMQQSNLGCKQYYIYSVDDYLTDVKFLDELITYRREKGVEITAI-RLESSPHVQHLKYHPEVYNKFVDGILEEAR 333 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig96119.22158.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig96119.22158.1 ID=prot_M-pyrifera_M_contig96119.22158.1|Name=mRNA_M-pyrifera_M_contig96119.22158.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=96bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|