prot_M-pyrifera_M_contig88346.20521.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig88346.20521.1 vs. uniprot
Match: A0A5A8E4R4_CAFRO (Ubiquitin carboxyl-terminal hydrolase n=2 Tax=Cafeteria roenbergensis TaxID=33653 RepID=A0A5A8E4R4_CAFRO) HSP 1 Score: 58.5 bits (140), Expect = 4.470e-8 Identity = 31/74 (41.89%), Postives = 44/74 (59.46%), Query Frame = 0 Query: 2 VDQRQSLGALREVIASVMGVPKDSFKILRTERGPEMKDGEKSLTYYGFMGGGRVWLRPGRPLSLGEVALKISLF 75 VDQRQ+LG LR + + +++R G EMKD K L ++G +GGG+V L GRPL+ E LK+ +F Sbjct: 494 VDQRQTLGELRRAVEGATRATPGTVRVMRPG-GFEMKDATKPLAFHGLLGGGKVRLERGRPLTPAEFTLKVVVF 566
BLAST of mRNA_M-pyrifera_M_contig88346.20521.1 vs. uniprot
Match: A0A5A8CLR4_CAFRO (USP domain-containing protein n=4 Tax=Cafeteria roenbergensis TaxID=33653 RepID=A0A5A8CLR4_CAFRO) HSP 1 Score: 58.5 bits (140), Expect = 4.520e-8 Identity = 31/74 (41.89%), Postives = 44/74 (59.46%), Query Frame = 0 Query: 2 VDQRQSLGALREVIASVMGVPKDSFKILRTERGPEMKDGEKSLTYYGFMGGGRVWLRPGRPLSLGEVALKISLF 75 VDQRQ+LG LR + + +++R G EMKD K L ++G +GGG+V L GRPL+ E LK+ +F Sbjct: 825 VDQRQTLGELRRAVEGATRATPGTVRVMRPG-GFEMKDATKPLAFHGLLGGGKVRLERGRPLTPAEFTLKVVVF 897 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig88346.20521.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig88346.20521.1 ID=prot_M-pyrifera_M_contig88346.20521.1|Name=mRNA_M-pyrifera_M_contig88346.20521.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=85bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|