mRNA_M-pyrifera_M_contig88346.20521.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig88346.20521.1 vs. uniprot
Match: A0A5A8E4R4_CAFRO (Ubiquitin carboxyl-terminal hydrolase n=2 Tax=Cafeteria roenbergensis TaxID=33653 RepID=A0A5A8E4R4_CAFRO) HSP 1 Score: 59.7 bits (143), Expect = 1.820e-8 Identity = 32/76 (42.11%), Postives = 45/76 (59.21%), Query Frame = 1 Query: 1 VMVDQRQSLGALREVIASVMGVPKDSFKILRTERGPEMKDGEKSLTYYGFMGGGRVWLRPGRPLSLGEVALKISLF 228 V VDQRQ+LG LR + + +++R G EMKD K L ++G +GGG+V L GRPL+ E LK+ +F Sbjct: 492 VQVDQRQTLGELRRAVEGATRATPGTVRVMRPG-GFEMKDATKPLAFHGLLGGGKVRLERGRPLTPAEFTLKVVVF 566
BLAST of mRNA_M-pyrifera_M_contig88346.20521.1 vs. uniprot
Match: A0A5A8CLR4_CAFRO (USP domain-containing protein n=4 Tax=Cafeteria roenbergensis TaxID=33653 RepID=A0A5A8CLR4_CAFRO) HSP 1 Score: 59.7 bits (143), Expect = 1.840e-8 Identity = 32/76 (42.11%), Postives = 45/76 (59.21%), Query Frame = 1 Query: 1 VMVDQRQSLGALREVIASVMGVPKDSFKILRTERGPEMKDGEKSLTYYGFMGGGRVWLRPGRPLSLGEVALKISLF 228 V VDQRQ+LG LR + + +++R G EMKD K L ++G +GGG+V L GRPL+ E LK+ +F Sbjct: 823 VQVDQRQTLGELRRAVEGATRATPGTVRVMRPG-GFEMKDATKPLAFHGLLGGGKVRLERGRPLTPAEFTLKVVVF 897 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig88346.20521.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig88346.20521.1 >prot_M-pyrifera_M_contig88346.20521.1 ID=prot_M-pyrifera_M_contig88346.20521.1|Name=mRNA_M-pyrifera_M_contig88346.20521.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=85bp MVDQRQSLGALREVIASVMGVPKDSFKILRTERGPEMKDGEKSLTYYGFMback to top mRNA from alignment at M-pyrifera_M_contig88346:517..774+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig88346.20521.1 ID=mRNA_M-pyrifera_M_contig88346.20521.1|Name=mRNA_M-pyrifera_M_contig88346.20521.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=258bp|location=Sequence derived from alignment at M-pyrifera_M_contig88346:517..774+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig88346:517..774+ >mRNA_M-pyrifera_M_contig88346.20521.1 ID=mRNA_M-pyrifera_M_contig88346.20521.1|Name=mRNA_M-pyrifera_M_contig88346.20521.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=510bp|location=Sequence derived from alignment at M-pyrifera_M_contig88346:517..774+ (Macrocystis pyrifera P11B4 male)back to top |