prot_M-pyrifera_M_contig88252.20492.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig88252.20492.1 vs. uniprot
Match: A0A6H5JXQ5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JXQ5_9PHAE) HSP 1 Score: 75.1 bits (183), Expect = 2.450e-14 Identity = 35/40 (87.50%), Postives = 39/40 (97.50%), Query Frame = 0 Query: 18 LGQLYVHQSGKSRLVIGGVSFVVHPGLPVSFVEKGVSIDA 57 +G+LYVHQSGK+RLVIGGVS VVHPGLPVSFVE+GVSIDA Sbjct: 349 IGKLYVHQSGKARLVIGGVSLVVHPGLPVSFVEQGVSIDA 388
BLAST of mRNA_M-pyrifera_M_contig88252.20492.1 vs. uniprot
Match: D8LHB7_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LHB7_ECTSI) HSP 1 Score: 75.1 bits (183), Expect = 2.540e-14 Identity = 35/40 (87.50%), Postives = 39/40 (97.50%), Query Frame = 0 Query: 18 LGQLYVHQSGKSRLVIGGVSFVVHPGLPVSFVEKGVSIDA 57 +G+LYVHQSGK+RLVIGGVS VVHPGLPVSFVE+GVSIDA Sbjct: 414 IGKLYVHQSGKARLVIGGVSLVVHPGLPVSFVEQGVSIDA 453 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig88252.20492.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig88252.20492.1 ID=prot_M-pyrifera_M_contig88252.20492.1|Name=mRNA_M-pyrifera_M_contig88252.20492.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=62bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|