mRNA_M-pyrifera_M_contig88252.20492.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig88252.20492.1 vs. uniprot
Match: A0A6H5JXQ5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JXQ5_9PHAE) HSP 1 Score: 75.1 bits (183), Expect = 2.450e-14 Identity = 35/40 (87.50%), Postives = 39/40 (97.50%), Query Frame = 1 Query: 52 LGQLYVHQSGKSRLVIGGVSFVVHPGLPVSFVEKGVSIDA 171 +G+LYVHQSGK+RLVIGGVS VVHPGLPVSFVE+GVSIDA Sbjct: 349 IGKLYVHQSGKARLVIGGVSLVVHPGLPVSFVEQGVSIDA 388
BLAST of mRNA_M-pyrifera_M_contig88252.20492.1 vs. uniprot
Match: D8LHB7_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LHB7_ECTSI) HSP 1 Score: 75.1 bits (183), Expect = 2.540e-14 Identity = 35/40 (87.50%), Postives = 39/40 (97.50%), Query Frame = 1 Query: 52 LGQLYVHQSGKSRLVIGGVSFVVHPGLPVSFVEKGVSIDA 171 +G+LYVHQSGK+RLVIGGVS VVHPGLPVSFVE+GVSIDA Sbjct: 414 IGKLYVHQSGKARLVIGGVSLVVHPGLPVSFVEQGVSIDA 453 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig88252.20492.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig88252.20492.1 >prot_M-pyrifera_M_contig88252.20492.1 ID=prot_M-pyrifera_M_contig88252.20492.1|Name=mRNA_M-pyrifera_M_contig88252.20492.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=62bp MLALNIPPPPPPPSSPCLGQLYVHQSGKSRLVIGGVSFVVHPGLPVSFVEback to top mRNA from alignment at M-pyrifera_M_contig88252:482..667- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig88252.20492.1 ID=mRNA_M-pyrifera_M_contig88252.20492.1|Name=mRNA_M-pyrifera_M_contig88252.20492.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=186bp|location=Sequence derived from alignment at M-pyrifera_M_contig88252:482..667- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig88252:482..667- >mRNA_M-pyrifera_M_contig88252.20492.1 ID=mRNA_M-pyrifera_M_contig88252.20492.1|Name=mRNA_M-pyrifera_M_contig88252.20492.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=372bp|location=Sequence derived from alignment at M-pyrifera_M_contig88252:482..667- (Macrocystis pyrifera P11B4 male)back to top |