prot_M-pyrifera_M_contig74708.17671.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig74708.17671.1 vs. uniprot
Match: A0A7W1JM88_9BACT (Tetratricopeptide repeat protein n=1 Tax=Armatimonadetes bacterium TaxID=2033014 RepID=A0A7W1JM88_9BACT) HSP 1 Score: 49.3 bits (116), Expect = 4.340e-5 Identity = 25/79 (31.65%), Postives = 42/79 (53.16%), Query Frame = 0 Query: 20 MDEDDFEHLMQEAIDAGSKGDLQRALPLFRRLAELDSENSAAWTNLGVTEMRAGHTEAAQEAYDRAMDLAPWDVTPRFN 98 M D + L+ +A D + + ++A + R+ E+D+ NS A+ LGV R G E A +A+ RA+ AP+ +N Sbjct: 1 MSTDQVKQLITDASDHVREQNFEKAAEIARQALEVDTRNSDAYGVLGVAFARLGRIEEATDAFQRAVQTAPYSARSYYN 79 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74708.17671.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig74708.17671.1 ID=prot_M-pyrifera_M_contig74708.17671.1|Name=mRNA_M-pyrifera_M_contig74708.17671.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=98bpback to top |