mRNA_M-pyrifera_M_contig74708.17671.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig74708.17671.1 vs. uniprot
Match: A0A7W1JM88_9BACT (Tetratricopeptide repeat protein n=1 Tax=Armatimonadetes bacterium TaxID=2033014 RepID=A0A7W1JM88_9BACT) HSP 1 Score: 49.3 bits (116), Expect = 4.340e-5 Identity = 25/79 (31.65%), Postives = 42/79 (53.16%), Query Frame = 1 Query: 58 MDEDDFEHLMQEAIDAGSKGDLQRALPLFRRLAELDSENSAAWTNLGVTEMRAGHTEAAQEAYDRAMDLAPWDVTPRFN 294 M D + L+ +A D + + ++A + R+ E+D+ NS A+ LGV R G E A +A+ RA+ AP+ +N Sbjct: 1 MSTDQVKQLITDASDHVREQNFEKAAEIARQALEVDTRNSDAYGVLGVAFARLGRIEEATDAFQRAVQTAPYSARSYYN 79 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74708.17671.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig74708.17671.1 >prot_M-pyrifera_M_contig74708.17671.1 ID=prot_M-pyrifera_M_contig74708.17671.1|Name=mRNA_M-pyrifera_M_contig74708.17671.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=98bp MCHTIFLSVLLCVFVVVGAMDEDDFEHLMQEAIDAGSKGDLQRALPLFRRback to top mRNA from alignment at M-pyrifera_M_contig74708:768..1061+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig74708.17671.1 ID=mRNA_M-pyrifera_M_contig74708.17671.1|Name=mRNA_M-pyrifera_M_contig74708.17671.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=294bp|location=Sequence derived from alignment at M-pyrifera_M_contig74708:768..1061+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig74708:768..1061+ >mRNA_M-pyrifera_M_contig74708.17671.1 ID=mRNA_M-pyrifera_M_contig74708.17671.1|Name=mRNA_M-pyrifera_M_contig74708.17671.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=588bp|location=Sequence derived from alignment at M-pyrifera_M_contig74708:768..1061+ (Macrocystis pyrifera P11B4 male)back to top |