prot_M-pyrifera_M_contig73982.17522.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig73982.17522.1 vs. uniprot
Match: A0A8C3RTT4_CHESE (RING-type domain-containing protein n=1 Tax=Chelydra serpentina TaxID=8475 RepID=A0A8C3RTT4_CHESE) HSP 1 Score: 53.9 bits (128), Expect = 1.690e-5 Identity = 23/57 (40.35%), Postives = 33/57 (57.89%), Query Frame = 0 Query: 5 EDLRVKIHGTVSDDCPICLERMANISIIQPCLHFTCKSCMSKLS---GKCPMCRSLF 58 ED+ V G+ CPICLER+ N+S + PC H C C+ + S +CP+C+ F Sbjct: 23 EDVPVAAEGSSDSRCPICLERIRNVSYLNPCFHGFCFVCIQEWSERKAECPLCKQYF 79 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig73982.17522.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig73982.17522.1 ID=prot_M-pyrifera_M_contig73982.17522.1|Name=mRNA_M-pyrifera_M_contig73982.17522.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=246bpback to top |