Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR006553 | Leucine-rich repeat, cysteine-containing subtype | SMART | SM00367 | LRR_CC_2 | coord: 89..114 e-value: 0.14 score: 21.2 coord: 63..88 e-value: 0.001 score: 28.4 coord: 11..36 e-value: 0.0075 score: 25.5 coord: 37..62 e-value: 1.4E-5 score: 34.5 |
IPR001611 | Leucine-rich repeat | PFAM | PF13516 | LRR_6 | coord: 11..34 e-value: 0.19 score: 11.9 coord: 36..60 e-value: 0.0098 score: 15.9 |
IPR032675 | Leucine-rich repeat domain superfamily | GENE3D | 3.80.10.10 | | coord: 1..119 e-value: 2.9E-30 score: 107.0 |
None | No IPR available | PANTHER | PTHR13382:SF6 | SCF E3 UBIQUITIN LIGASE COMPLEX F-BOX PROTEIN GRR1 | coord: 1..112 |
None | No IPR available | PANTHER | PTHR13382 | MITOCHONDRIAL ATP SYNTHASE COUPLING FACTOR B | coord: 1..112 |
None | No IPR available | SUPERFAMILY | 52047 | RNI-like | coord: 4..106 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig7364.17450.1 ID=prot_M-pyrifera_M_contig7364.17450.1|Name=mRNA_M-pyrifera_M_contig7364.17450.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=121bp DVGVRALAVGCSGLKALGLRDCGQVTDSALEALSLHCSSLEWLDLSWCGG VSDRGLVRLAKSCPDLEEVQAVWCENITDASLAALSAFCKHLEALHVGGC RGVTPSAVAALREKGVEVLQ* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|