prot_M-pyrifera_M_contig70225.16784.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig70225.16784.1 vs. uniprot
Match: D7FWZ8_ECTSI (TPR repeat-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FWZ8_ECTSI) HSP 1 Score: 50.1 bits (118), Expect = 2.800e-6 Identity = 26/27 (96.30%), Postives = 27/27 (100.00%), Query Frame = 0 Query: 1 RLVRAAGKLEEAEPLQRRAVEIGEKVL 27 RLVRAAGKLEEAEPLQRRAVEIGE+VL Sbjct: 18 RLVRAAGKLEEAEPLQRRAVEIGEQVL 44
BLAST of mRNA_M-pyrifera_M_contig70225.16784.1 vs. uniprot
Match: D8LLM3_ECTSI (Kinesin light chain-like protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LLM3_ECTSI) HSP 1 Score: 49.7 bits (117), Expect = 4.870e-6 Identity = 25/44 (56.82%), Postives = 30/44 (68.18%), Query Frame = 0 Query: 2 LVRAAGKLEEAEPLQRRAVEIGEKVLGSNSPDLATWANNLGRLL 45 L A G+ EA+PL RA+E+GEK LG + PDLATW NN LL Sbjct: 3 LPHALGEDTEADPLYLRAIEVGEKKLGPDHPDLATWLNNQAVLL 46
BLAST of mRNA_M-pyrifera_M_contig70225.16784.1 vs. uniprot
Match: A0A6H5JJK0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JJK0_9PHAE) HSP 1 Score: 50.8 bits (120), Expect = 8.150e-6 Identity = 25/48 (52.08%), Postives = 28/48 (58.33%), Query Frame = 0 Query: 1 RLVRAAGKLEEAEPLQRRAVEIGEKVLGSNSPDLATWANNLGRLLMVR 48 RL G EA+P RA+EIGEKVLG PDLA W NN LL + Sbjct: 638 RLHELEGNFAEADPFNLRAIEIGEKVLGPEHPDLAVWLNNRAELLRAQ 685
BLAST of mRNA_M-pyrifera_M_contig70225.16784.1 vs. uniprot
Match: A0A7S3NLU4_9STRA (Hypothetical protein (Fragment) n=1 Tax=Aureoumbra lagunensis TaxID=44058 RepID=A0A7S3NLU4_9STRA) HSP 1 Score: 48.9 bits (115), Expect = 1.390e-5 Identity = 22/36 (61.11%), Postives = 27/36 (75.00%), Query Frame = 0 Query: 2 LVRAAGKLEEAEPLQRRAVEIGEKVLGSNSPDLATW 37 L+ + GK EA+PL RA+EIGEK LG N P+LATW Sbjct: 8 LLESQGKYNEAKPLYERAIEIGEKTLGPNHPNLATW 43
BLAST of mRNA_M-pyrifera_M_contig70225.16784.1 vs. uniprot
Match: A0A6H5K0C4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K0C4_9PHAE) HSP 1 Score: 47.8 bits (112), Expect = 8.850e-5 Identity = 24/38 (63.16%), Postives = 28/38 (73.68%), Query Frame = 0 Query: 3 VRAAGKLEEAEPLQRRAVEIGEKVLGSNSPDLATWANN 40 VR GK EA+PL RA+EIGEK+LG + PDLAT NN Sbjct: 165 VRFRGKYAEADPLYLRAIEIGEKMLGPDHPDLATRLNN 202 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig70225.16784.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 5
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig70225.16784.1 ID=prot_M-pyrifera_M_contig70225.16784.1|Name=mRNA_M-pyrifera_M_contig70225.16784.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=59bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|