mRNA_M-pyrifera_M_contig91543.21214.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig91543.21214.1 vs. uniprot
Match: A0A0P1GAU3_9RHOB (Beta-glucanase n=2 Tax=Thalassobius autumnalis TaxID=2072972 RepID=A0A0P1GAU3_9RHOB) HSP 1 Score: 50.8 bits (120), Expect = 8.150e-5 Identity = 26/79 (32.91%), Postives = 41/79 (51.90%), Query Frame = 1 Query: 55 NEMDICLKGAENEGETGSFHAATWINGTEDFADVPLDFSPAKELAEFKMHWYADRIDWFVNGKMLHQVTKQ-DAIPWEP 288 +E+DI G + T H + W++G + VPL F A + W+ DR+ WFV G+++H+V + AIP P Sbjct: 190 DEIDIEFLGRD----TRKLHLSWWVDGVLNSHVVPLGFDAADGPRLYAFEWHPDRLRWFVEGRLVHEVRAETSAIPAVP 264 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig91543.21214.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig91543.21214.1 >prot_M-pyrifera_M_contig91543.21214.1 ID=prot_M-pyrifera_M_contig91543.21214.1|Name=mRNA_M-pyrifera_M_contig91543.21214.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=127bp PPGNAFVCISTYIHDPVWNEMDICLKGAENEGETGSFHAATWINGTEDFAback to top mRNA from alignment at M-pyrifera_M_contig91543:334..714+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig91543.21214.1 ID=mRNA_M-pyrifera_M_contig91543.21214.1|Name=mRNA_M-pyrifera_M_contig91543.21214.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=381bp|location=Sequence derived from alignment at M-pyrifera_M_contig91543:334..714+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig91543:334..714+ >mRNA_M-pyrifera_M_contig91543.21214.1 ID=mRNA_M-pyrifera_M_contig91543.21214.1|Name=mRNA_M-pyrifera_M_contig91543.21214.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=762bp|location=Sequence derived from alignment at M-pyrifera_M_contig91543:334..714+ (Macrocystis pyrifera P11B4 male)back to top |