prot_M-pyrifera_M_contig91543.21214.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig91543.21214.1 vs. uniprot
Match: A0A0P1GAU3_9RHOB (Beta-glucanase n=2 Tax=Thalassobius autumnalis TaxID=2072972 RepID=A0A0P1GAU3_9RHOB) HSP 1 Score: 50.8 bits (120), Expect = 8.150e-5 Identity = 26/79 (32.91%), Postives = 41/79 (51.90%), Query Frame = 0 Query: 19 NEMDICLKGAENEGETGSFHAATWINGTEDFADVPLDFSPAKELAEFKMHWYADRIDWFVNGKMLHQVTKQ-DAIPWEP 96 +E+DI G + T H + W++G + VPL F A + W+ DR+ WFV G+++H+V + AIP P Sbjct: 190 DEIDIEFLGRD----TRKLHLSWWVDGVLNSHVVPLGFDAADGPRLYAFEWHPDRLRWFVEGRLVHEVRAETSAIPAVP 264 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig91543.21214.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig91543.21214.1 ID=prot_M-pyrifera_M_contig91543.21214.1|Name=mRNA_M-pyrifera_M_contig91543.21214.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=127bpback to top |