mRNA_M-pyrifera_M_contig79810.18722.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig79810.18722.1 vs. uniprot
Match: A7NQ13_ROSCS (FHA domain containing protein n=2 Tax=Roseiflexus castenholzii TaxID=120962 RepID=A7NQ13_ROSCS) HSP 1 Score: 57.8 bits (138), Expect = 6.380e-8 Identity = 27/71 (38.03%), Postives = 44/71 (61.97%), Query Frame = 1 Query: 1 NKLFIEDIRLSRNHLMVTWSQAGWMAEDLNSYGGTMLTRTEVMHQPVELRAGDVLSLSDGIVTLTVAQAVH 213 N + ++D ++SR+HL +TW+ A ++AED+ S GGT+L + P LR GD L+L D ++ L + V Sbjct: 70 NTILLDDPKISRHHLRLTWNGAAFVAEDVGSSGGTLLNGVS-LRAPTALRPGDTLTLGDTMLRLGIVSEVE 139 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig79810.18722.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig79810.18722.1 >prot_M-pyrifera_M_contig79810.18722.1 ID=prot_M-pyrifera_M_contig79810.18722.1|Name=mRNA_M-pyrifera_M_contig79810.18722.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=78bp NKLFIEDIRLSRNHLMVTWSQAGWMAEDLNSYGGTMLTRTEVMHQPVELRback to top mRNA from alignment at M-pyrifera_M_contig79810:421..717+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig79810.18722.1 ID=mRNA_M-pyrifera_M_contig79810.18722.1|Name=mRNA_M-pyrifera_M_contig79810.18722.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=297bp|location=Sequence derived from alignment at M-pyrifera_M_contig79810:421..717+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig79810:421..717+ >mRNA_M-pyrifera_M_contig79810.18722.1 ID=mRNA_M-pyrifera_M_contig79810.18722.1|Name=mRNA_M-pyrifera_M_contig79810.18722.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=468bp|location=Sequence derived from alignment at M-pyrifera_M_contig79810:421..717+ (Macrocystis pyrifera P11B4 male)back to top |