prot_M-pyrifera_M_contig79810.18722.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig79810.18722.1 vs. uniprot
Match: A7NQ13_ROSCS (FHA domain containing protein n=2 Tax=Roseiflexus castenholzii TaxID=120962 RepID=A7NQ13_ROSCS) HSP 1 Score: 57.8 bits (138), Expect = 6.380e-8 Identity = 27/71 (38.03%), Postives = 44/71 (61.97%), Query Frame = 0 Query: 1 NKLFIEDIRLSRNHLMVTWSQAGWMAEDLNSYGGTMLTRTEVMHQPVELRAGDVLSLSDGIVTLTVAQAVH 71 N + ++D ++SR+HL +TW+ A ++AED+ S GGT+L + P LR GD L+L D ++ L + V Sbjct: 70 NTILLDDPKISRHHLRLTWNGAAFVAEDVGSSGGTLLNGVS-LRAPTALRPGDTLTLGDTMLRLGIVSEVE 139 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig79810.18722.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig79810.18722.1 ID=prot_M-pyrifera_M_contig79810.18722.1|Name=mRNA_M-pyrifera_M_contig79810.18722.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=78bpback to top |