mRNA_M-pyrifera_M_contig785.18449.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig785.18449.1 vs. uniprot
Match: A0A6H5JUA1_9PHAE (MFS domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5JUA1_9PHAE) HSP 1 Score: 67.8 bits (164), Expect = 4.600e-12 Identity = 33/40 (82.50%), Postives = 35/40 (87.50%), Query Frame = 1 Query: 1 KGWIIDAMEILVVAFVLEDVADTFGLNSVQKGLIGSASFF 120 GW+IDAMEILVVAFVLED+A TF L SV KGLIGSASFF Sbjct: 16 NGWVIDAMEILVVAFVLEDIATTFELGSVGKGLIGSASFF 55
BLAST of mRNA_M-pyrifera_M_contig785.18449.1 vs. uniprot
Match: D7FV27_ECTSI (Major facilitator transporter n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FV27_ECTSI) HSP 1 Score: 48.9 bits (115), Expect = 2.090e-5 Identity = 23/33 (69.70%), Postives = 29/33 (87.88%), Query Frame = 1 Query: 22 MEILVVAFVLEDVADTFGLNSVQKGLIGSASFF 120 ME+LV+AF LE +A +F L+SV+KGLIGSASFF Sbjct: 1 MEVLVLAFALEAIATSFELSSVEKGLIGSASFF 33 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig785.18449.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig785.18449.1 >prot_M-pyrifera_M_contig785.18449.1 ID=prot_M-pyrifera_M_contig785.18449.1|Name=mRNA_M-pyrifera_M_contig785.18449.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=38bp MEILVVAFVLEDVADTFGLNSVQKGLIGSASFFVEPE*back to top mRNA from alignment at M-pyrifera_M_contig785:10626..10760+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig785.18449.1 ID=mRNA_M-pyrifera_M_contig785.18449.1|Name=mRNA_M-pyrifera_M_contig785.18449.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=135bp|location=Sequence derived from alignment at M-pyrifera_M_contig785:10626..10760+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig785:10626..10760+ >mRNA_M-pyrifera_M_contig785.18449.1 ID=mRNA_M-pyrifera_M_contig785.18449.1|Name=mRNA_M-pyrifera_M_contig785.18449.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=228bp|location=Sequence derived from alignment at M-pyrifera_M_contig785:10626..10760+ (Macrocystis pyrifera P11B4 male)back to top |