mRNA_M-pyrifera_M_contig76119.17956.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig76119.17956.1 vs. uniprot
Match: A0A2V0NLE0_9CHLO (Uncharacterized protein n=1 Tax=Raphidocelis subcapitata TaxID=307507 RepID=A0A2V0NLE0_9CHLO) HSP 1 Score: 60.8 bits (146), Expect = 3.550e-8 Identity = 24/42 (57.14%), Postives = 31/42 (73.81%), Query Frame = 1 Query: 25 VMDVKFHPDGSIVAGCMADGTVKLWDARCDALLQHYAAHSSA 150 + V FHPDG+ +A C AD ++K+WD R DALLQHY AH+ A Sbjct: 201 ISSVAFHPDGTALASCCADASIKIWDMRSDALLQHYRAHTGA 242
BLAST of mRNA_M-pyrifera_M_contig76119.17956.1 vs. uniprot
Match: A0A8J2F7Q1_9DINO (Hypothetical protein n=1 Tax=Amoebophrya sp. A25 TaxID=1410381 RepID=A0A8J2F7Q1_9DINO) HSP 1 Score: 52.0 bits (123), Expect = 4.460e-5 Identity = 23/48 (47.92%), Postives = 29/48 (60.42%), Query Frame = 1 Query: 22 RVMDVKFHPDGSIVAGCMADGTVKLWDARCDALLQHYAAHSSAAHHID 165 RV FHPDG+ +A C D T+K+WD R L+QHY AH A +D Sbjct: 232 RVNRSIFHPDGTCIASCSDDRTIKIWDLRRRRLIQHYDAHGGAVLDLD 279 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig76119.17956.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig76119.17956.1 >prot_M-pyrifera_M_contig76119.17956.1 ID=prot_M-pyrifera_M_contig76119.17956.1|Name=mRNA_M-pyrifera_M_contig76119.17956.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=125bp MDVKFHPDGSIVAGCMADGTVKLWDARCDALLQHYAAHSSAAHHIDFHPSback to top mRNA from alignment at M-pyrifera_M_contig76119:51..452+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig76119.17956.1 ID=mRNA_M-pyrifera_M_contig76119.17956.1|Name=mRNA_M-pyrifera_M_contig76119.17956.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=402bp|location=Sequence derived from alignment at M-pyrifera_M_contig76119:51..452+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig76119:51..452+ >mRNA_M-pyrifera_M_contig76119.17956.1 ID=mRNA_M-pyrifera_M_contig76119.17956.1|Name=mRNA_M-pyrifera_M_contig76119.17956.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=750bp|location=Sequence derived from alignment at M-pyrifera_M_contig76119:51..452+ (Macrocystis pyrifera P11B4 male)back to top |