mRNA_M-pyrifera_M_contig105687.1222.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig105687.1222.1 vs. uniprot
Match: A0A7S1GD51_9STRA (Hypothetical protein (Fragment) n=1 Tax=Bicosoecida sp. CB-2014 TaxID=1486930 RepID=A0A7S1GD51_9STRA) HSP 1 Score: 60.8 bits (146), Expect = 1.710e-8 Identity = 38/129 (29.46%), Postives = 64/129 (49.61%), Query Frame = 1 Query: 10 PFSLCLFVSVLVSLTPAIAGFVVLGTIGDAGGCE-------------PSLVG-WAVGQSLVLLSNFLIALYLCWRLGGPYDISKQEDVDFLARATYAVCEDPAMALYILILLFSVAWTIVGHIWLGEAN 354 P + C ++LV+L PA A V+L A G E P G W V Q L+ + +++ + + PYD + D DF +R + +CED +A+++L+L+FS+ W +G W+G + Sbjct: 80 PMAPCALFALLVNLLPACALAVILALAPTAKGMEQYGSNFSAAQALCPQPAGLWLVVQILIFYVDCVLSWRMMLKFRHPYDYTNPADKDFYSRLCHMLCEDVGVAVWMLVLIFSLVWQGLGISWVGASR 208 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig105687.1222.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig105687.1222.1 >prot_M-pyrifera_M_contig105687.1222.1 ID=prot_M-pyrifera_M_contig105687.1222.1|Name=mRNA_M-pyrifera_M_contig105687.1222.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=118bp FERPFSLCLFVSVLVSLTPAIAGFVVLGTIGDAGGCEPSLVGWAVGQSLVback to top mRNA from alignment at M-pyrifera_M_contig105687:3..356+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig105687.1222.1 ID=mRNA_M-pyrifera_M_contig105687.1222.1|Name=mRNA_M-pyrifera_M_contig105687.1222.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=354bp|location=Sequence derived from alignment at M-pyrifera_M_contig105687:3..356+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig105687:3..356+ >mRNA_M-pyrifera_M_contig105687.1222.1 ID=mRNA_M-pyrifera_M_contig105687.1222.1|Name=mRNA_M-pyrifera_M_contig105687.1222.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=708bp|location=Sequence derived from alignment at M-pyrifera_M_contig105687:3..356+ (Macrocystis pyrifera P11B4 male)back to top |