prot_M-pyrifera_M_contig105687.1222.1 (polypeptide) Macrocystis pyrifera P11B4 male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	mRNA_M-pyrifera_M_contig105687.1222.1
Unique Name	prot_M-pyrifera_M_contig105687.1222.1
Type	polypeptide
Organism	Macrocystis pyrifera P11B4 male (Macrocystis pyrifera P11B4 male (Giant kelp))
Sequence length	118

Homology

[Close]

BLAST of mRNA_M-pyrifera_M_contig105687.1222.1 vs. uniprot
Match: A0A7S1GD51_9STRA (Hypothetical protein (Fragment) n=1 Tax=Bicosoecida sp. CB-2014 TaxID=1486930 RepID=A0A7S1GD51_9STRA)

HSP 1 Score: 60.8 bits (146), Expect = 1.710e-8
Identity = 38/129 (29.46%), Postives = 64/129 (49.61%), Query Frame = 0

Query:    4 PFSLCLFVSVLVSLTPAIAGFVVLGTIGDAGGCE-------------PSLVG-WAVGQSLVLLSNFLIALYLCWRLGGPYDISKQEDVDFLARATYAVCEDPAMALYILILLFSVAWTIVGHIWLGEAN 118
            P + C   ++LV+L PA A  V+L     A G E             P   G W V Q L+   + +++  +  +   PYD +   D DF +R  + +CED  +A+++L+L+FS+ W  +G  W+G + 
Sbjct:   80 PMAPCALFALLVNLLPACALAVILALAPTAKGMEQYGSNFSAAQALCPQPAGLWLVVQILIFYVDCVLSWRMMLKFRHPYDYTNPADKDFYSRLCHMLCEDVGVAVWMLVLIFSLVWQGLGISWVGASR 208

The following BLAST results are available for this feature:

BLAST of mRNA_M-pyrifera_M_contig105687.1222.1 vs. uniprot

BLAST of mRNA_M-pyrifera_M_contig105687.1222.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90)
Total hits: 1


Match Name	E-value	Identity	Description
A0A7S1GD51_9STRA	1.710e-8	29.46	Hypothetical protein (Fragment) n=1 Tax=Bicosoecid...	[more]

InterPro

Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 64..91
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 92..114
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 7..28
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 40..63
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 115..118
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 29..39
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 1..6
None	No IPR available	SIGNALP_EUK	SignalP-TM	SignalP-TM	coord: 1..23 score: 0.562
None	No IPR available	TMHMM	TMhelix		coord: 92..114
None	No IPR available	TMHMM	TMhelix		coord: 9..31
None	No IPR available	TMHMM	TMhelix		coord: 41..63

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
M-pyrifera_M_contig105687	contig	M-pyrifera_M_contig105687:3..356 +

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0 of Macrocystis pyrifera male	2022-09-29
Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90	2022-09-16
OGS1.0 of Macrocystis pyrifera P11B4 male	2021-02-24

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
mRNA_M-pyrifera_M_contig105687.1222.1	mRNA_M-pyrifera_M_contig105687.1222.1	Macrocystis pyrifera P11B4 male	mRNA	M-pyrifera_M_contig105687 3..356 +

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>prot_M-pyrifera_M_contig105687.1222.1 ID=prot_M-pyrifera_M_contig105687.1222.1|Name=mRNA_M-pyrifera_M_contig105687.1222.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=118bp
FERPFSLCLFVSVLVSLTPAIAGFVVLGTIGDAGGCEPSLVGWAVGQSLV
LLSNFLIALYLCWRLGGPYDISKQEDVDFLARATYAVCEDPAMALYILIL
LFSVAWTIVGHIWLGEAN