mRNA_M-pyrifera_M_contig104329.920.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104329.920.1 vs. uniprot
Match: A0A7S4HYS1_9EUKA (Hypothetical protein (Fragment) n=1 Tax=Vannella sp. CB-2014 TaxID=1487602 RepID=A0A7S4HYS1_9EUKA) HSP 1 Score: 101 bits (252), Expect = 6.560e-24 Identity = 43/89 (48.31%), Postives = 65/89 (73.03%), Query Frame = 1 Query: 70 TAEPCTFTEGGFYSYDDVAQCFYSIRLDETFKLQTLDTMRKALELYTFFDIANHSPDPHLPVEIDMVAGLQQIEDRPYVYDMDFHSDMR 336 ++ PC F EG +Y Y++ +CF SI L + K TL T+ ++LELYTF+DIA++SPDP+LP++++M GLQ+I R Y+ D DF +D+R Sbjct: 21 SSSPCVFDEGEYYDYEETLECFMSIPLTDDIKFTTLATLNRSLELYTFYDIAHNSPDPNLPMQVNMQQGLQEIASRDYLTDFDFQNDLR 109 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104329.920.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig104329.920.1 >prot_M-pyrifera_M_contig104329.920.1 ID=prot_M-pyrifera_M_contig104329.920.1|Name=mRNA_M-pyrifera_M_contig104329.920.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=107bp MVVAAVVACLILPGEAQSTAEPCTFTEGGFYSYDDVAQCFYSIRLDETFKback to top mRNA from alignment at M-pyrifera_M_contig104329:308..643+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig104329.920.1 ID=mRNA_M-pyrifera_M_contig104329.920.1|Name=mRNA_M-pyrifera_M_contig104329.920.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=336bp|location=Sequence derived from alignment at M-pyrifera_M_contig104329:308..643+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig104329:308..643+ >mRNA_M-pyrifera_M_contig104329.920.1 ID=mRNA_M-pyrifera_M_contig104329.920.1|Name=mRNA_M-pyrifera_M_contig104329.920.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=642bp|location=Sequence derived from alignment at M-pyrifera_M_contig104329:308..643+ (Macrocystis pyrifera P11B4 male)back to top |